Property Summary

NCBI Gene PubMed Count 31
Grant Count 36
R01 Count 24
Funding $3,495,247.42
PubMed Score 26.84
PubTator Score 46.62

Knowledge Summary

Patent

No data available

Expression

Pathway (1)

Gene RIF (24)

PMID Text
26101826 pathogenic PINK1 mutants which are not cleaved by PARL affect PINK1 kinase activity and the ability to induce PARK2-mediated mitophagy.
25354644 Common genetic variants of the PINK1 and PARL genes are unlikely to be involved in schizophrenia.
23973714 the frequency of the haplotype AAC, and AAT were significantly higher in the unaffected cases and the frequencies of haplotype GGT were significantly higher in LHON cases
22915595 Rhomboid protease PARL mediates the mitochondrial membrane potential loss-induced cleavage of PGAM5.
21953724 p.S77N variant, and, possibly, mutations in the PARL protein overall, are not a frequent cause of autosomal recessive early-onset Parkinson's disease
21426348 the PARL-catalyzed removal of the Pink1 signal sequence in the canonical import pathway acts as a cellular checkpoint for mitochondrial integrity
21415861 work provides unexpected insights into the structural determinants regulating Parl stability and activity in vivo, and reveals a complex cascade of proteolytic events controlling the function of the protease in the mitochondrion
21355049 PARL deficiency impairs PARKIN recruitment to mitochondria.
21138942 Mitochondrial protease PARL cleaves PINK1 at position A103.
20877624 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAWRGWAQRGWGCGQAWGASVGGRSCEELTAVLTPPQLLGRRFNFFIQQKCGFRKAPRKVEPRRSDPGTS      1 - 70
GEAYKRSALIPPVEETVFYPSPYPIRSLIKPLFFTVGFTGCAFGSAAIWQYESLKSRVQSYFDGIKADWL     71 - 140
DSIRPQKEGDFRKEINKWWNNLSDGQRTVTGIIAANVLVFCLWRVPSLQRTMIRYFTSNPASKVLCSPML    141 - 210
LSTFSHFSLFHMAANMYVLWSFSSSIVNILGQEQFMAVYLSAGVISNFVSYVGKVATGRYGPSLGASGAI    211 - 280
MTVLAAVCTKIPEGRLAIIFLPMFTFTAGNALKAIIAMDTAGMILGWKFFDHAAHLGGALFGIWYVTYGH    281 - 350
ELIWKNREPLVKIWHEIRTNGPKKGGGSK                                             351 - 379
//

Text Mined References (32)

PMID Year Title
26101826 2015 Intramembrane protease PARL defines a negative regulator of PINK1- and PARK2/Parkin-dependent mitophagy.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25354644 2015 Common variants of the PINK1 and PARL genes do not confer genetic susceptibility to schizophrenia in Han Chinese.
24603532 2014 ABCC5, a gene that influences the anterior chamber depth, is associated with primary angle closure glaucoma.
24522549 2014 Oxidative stress-induced signaling pathways implicated in the pathogenesis of Parkinson's disease.
24099009 2013 The mitochondrial rhomboid protease: its rise from obscurity to the pinnacle of disease-relevant genes.
23973714 2013 Identification of the variants in PARL, the nuclear modifier gene, responsible for the expression of LHON patients in Thailand.
22915595 2012 Rhomboid protease PARL mediates the mitochondrial membrane potential loss-induced cleavage of PGAM5.
21953724 2011 The p.S77N presenilin-associated rhomboid-like protein mutation is not a frequent cause of early-onset Parkinson's disease.
21426348 2011 The mitochondrial intramembrane protease PARL cleaves human Pink1 to regulate Pink1 trafficking.
More...