Property Summary

NCBI Gene PubMed Count 36
PubMed Score 31.70
PubTator Score 46.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count
Schizophrenia 1160
Disease Target Count Z-score Confidence
Optic nerve disease 10 3.043 1.5

Expression

Protein-protein Interaction (4)

Gene RIF (29)

AA Sequence

MAWRGWAQRGWGCGQAWGASVGGRSCEELTAVLTPPQLLGRRFNFFIQQKCGFRKAPRKVEPRRSDPGTS      1 - 70
GEAYKRSALIPPVEETVFYPSPYPIRSLIKPLFFTVGFTGCAFGSAAIWQYESLKSRVQSYFDGIKADWL     71 - 140
DSIRPQKEGDFRKEINKWWNNLSDGQRTVTGIIAANVLVFCLWRVPSLQRTMIRYFTSNPASKVLCSPML    141 - 210
LSTFSHFSLFHMAANMYVLWSFSSSIVNILGQEQFMAVYLSAGVISNFVSYVGKVATGRYGPSLGASGAI    211 - 280
MTVLAAVCTKIPEGRLAIIFLPMFTFTAGNALKAIIAMDTAGMILGWKFFDHAAHLGGALFGIWYVTYGH    281 - 350
ELIWKNREPLVKIWHEIRTNGPKKGGGSK                                             351 - 379
//

Text Mined References (36)

PMID Year Title