Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.81
PubTator Score 0.36

Knowledge Summary

Patent

No data available

AA Sequence

MSLSPKHTTPFSVSDILSPIEETYKKFSGAMDGAPPGLGAPLGAAAAYRAPPPGPSSQAATVAGMQPSHA      1 - 70
MAGHNAAAAAAAAAAAAAAAATYHMPPGVSQFPHGAMGSYCNGGLGNMGELPAYTDGMRGGAATGWYGAN     71 - 140
PDPRYSSISRFMGPSAGVNVAGMGSLTGIADAAKSLGPLHAAAAAAAPRRKRRVLFSQAQVYELERRFKQ    141 - 210
QKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQLQQEGGLGPPPPPPPSPRRVAVPVL    211 - 280
VKDGKPCQNGASTPTPGQAGPQPPAPTPAPELEELSPSPPALHGPGGGLAALDAAAGEYSGGVLGANLLY    281 - 350
GRTW                                                                      351 - 354
//

Text Mined References (4)

PMID Year Title
24925725 2014 Lupus nephritis susceptibility loci in women with systemic lupus erythematosus.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
10818213 2000 Conserved linkage of NK-2 homeobox gene pairs Nkx2-2/2-4 and Nkx2-1/2-9 in mammals.
1346742 1992 Regional expression of the homeobox gene Nkx-2.2 in the developing mammalian forebrain.