Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.89
PubTator Score 4.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 5.94163800136062E-38
lung carcinoma 2844 3.82953909979473E-11
juvenile dermatomyositis 1189 3.76672386660869E-10
oligodendroglioma 2849 1.26075760605057E-8
pituitary cancer 1972 2.4910053818952E-5
group 3 medulloblastoma 2254 3.11304672447283E-5
interstitial cystitis 2299 4.98150903433486E-4
nasopharyngeal carcinoma 1056 8.3138595779427E-4
primitive neuroectodermal tumor 3031 0.00190406578027324
cutaneous lupus erythematosus 1056 0.00287790309555304
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00937656356735274
active Crohn's disease 918 0.0102500669981322
pediatric high grade glioma 2712 0.0273810042178305
primary Sjogren syndrome 789 0.0276405200854821
subependymal giant cell astrocytoma 2287 0.0370630634956746
medulloblastoma, large-cell 6234 0.0381629309784046
active ulcerative colitis 477 0.0384692287252484
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

Synonym

Accession Q9H2Y9 A4QPC2 B2RPF7 B3KMU7 E9PKK5 G3V1C0
Symbols OATPJ
OATP-J
OATP5A1
OATPRP4
OATP-RP4
SLC21A15

Gene

PANTHER Protein Class (1)

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (5)

PMID Text
25301452 High OATP5A1 expression is associated with small cell lung cancer.
24376674 SLCO5A1 is an organic anion transporting polypeptide which is involved in biological processes that require the reorganization of the cell shape, such as differentiation and migration.
21278488 tissue-specific localization of OATP2B1, OATP3A1 and OATP5A1 has been analyzed in normal mammary tissue and corresponding breast cancer tissues.
20602915 Haploinsufficiency of SULF1 combined with haploinsufficiency of SLCO5A1 (or the altered expression of a neighboring gene through position effect) could be necessary in the pathogenesis of MSS.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MDEGTGLQPGAGEQLEAPATAEAVQERCEPETLRSKSLPVLSSASCRPSLSPTSGDANPAFGCVDSSGHQ      1 - 70
ELKQGPNPLAPSPSAPSTSAGLGDCNHRVDLSKTFSVSSALAMLQERRCLYVVLTDSRCFLVCMCFLTFI     71 - 140
QALMVSGYLSSVITTIERRYSLKSSESGLLVSCFDIGNLVVVVFVSYFGGRGRRPLWLAVGGLLIAFGAA    141 - 210
LFALPHFISPPYQIQELNASAPNDGLCQGGNSTATLEPPACPKDSGGNNHWVYVALFICAQILIGMGSTP    211 - 280
IYTLGPTYLDDNVKKENSSLYLAIMYVMGALGPAVGYLLGGLLIGFYVDPRNPVHLDQNDPRFIGNWWSG    281 - 350
FLLCAIAMFLVIFPMFTFPKKLPPRHKKKKKKKFSVDAVSDDDVLKEKSNNSEQADKKVSSMGFGKDVRD    351 - 420
LPRAAVRILSNMTFLFVSLSYTAESAIVTAFITFIPKFIESQFGIPASNASIYTGVIIVPSAGVGIVLGG    421 - 490
YIIKKLKLGARESAKLAMICSGVSLLCFSTLFIVGCESINLGGINIPYTTGPSLTMPHRNLTGSCNVNCG    491 - 560
CKIHEYEPVCGSDGITYFNPCLAGCVNSGNLSTGIRNYTECTCVQSRQVITPPTVGQRSQLRVVIVKTYL    561 - 630
NENGYAVSGKCKRTCNTLIPFLVFLFIVTFITACAQPSAIIVTLRSVEDEERPFALGMQFVLLRTLAYIP    631 - 700
TPIYFGAVIDTTCMLWQQECGVQGSCWEYNVTSFRFVYFGLAAGLKFVGFIFIFLAWYSIKYKEDGLQRR    701 - 770
RQREFPLSTVSERVGHPDNARTRSCPAFSTQGEFHEETGLQKGIQCAAQTYPGPFPEAISSSADPGLEES    771 - 840
PAALEPPS                                                                  841 - 848
//

Text Mined References (12)

PMID Year Title
25301452 2015 Specific expression of OATPs in primary small cell lung cancer (SCLC) cells as novel biomarkers for diagnosis and therapy.
24376674 2013 Characterization of SLCO5A1/OATP5A1, a solute carrier transport protein with non-classical function.
23934736 2013 Genome-wide association study of a heart failure related metabolomic profile among African Americans in the Atherosclerosis Risk in Communities (ARIC) study.
21278488 2011 Expression and localization of the uptake transporters OATP2B1, OATP3A1 and OATP5A1 in non-malignant and malignant breast tissue.
20602915 2010 Mesomelia-synostoses syndrome results from deletion of SULF1 and SLCO5A1 genes at 8q13.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20041166 2009 Common genetic variation and the control of HIV-1 in humans.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...