Property Summary

NCBI Gene PubMed Count 49
PubMed Score 402.77
PubTator Score 155.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -4.100 2.8e-10
astrocytic glioma -2.900 4.5e-03
Astrocytoma, Pilocytic -5.900 1.1e-14
atypical teratoid / rhabdoid tumor -4.700 1.1e-10
ependymoma -4.500 9.0e-04
glioblastoma -4.900 8.1e-12
group 3 medulloblastoma -4.700 2.9e-09
medulloblastoma, large-cell -4.600 3.0e-08
oligodendroglioma -2.400 2.1e-02
ovarian cancer 1.900 5.1e-10
Pick disease -1.800 3.0e-02
pituitary cancer 2.200 7.8e-07
primitive neuroectodermal tumor -3.400 1.1e-03
subependymal giant cell astrocytoma -4.225 1.7e-02

Gene RIF (38)

AA Sequence

MSRRFTVTSLPPAGPARSPDPESRRHSVADPRHLPGEDVKGDGNPKESSPFINSTDTEKGKEYDGKNMAL      1 - 70
FEEEMDTSPMVSSLLSGLANYTNLPQGSREHEEAENNEGGKKKPVQAPRMGTFMGVYLPCLQNIFGVILF     71 - 140
LRLTWVVGIAGIMESFCMVFICCSCTMLTAISMSAIATNGVVPAGGSYYMISRSLGPEFGGAVGLCFYLG    141 - 210
TTFAGAMYILGTIEILLAYLFPAMAIFKAEDASGEAAAMLNNMRVYGTCVLTCMATVVFVGVKYVNKFAL    211 - 280
VFLGCVILSILAIYAGVIKSAFDPPNFPICLLGNRTLSRHGFDVCAKLAWEGNETVTTRLWGLFCSSRFL    281 - 350
NATCDEYFTRNNVTEIQGIPGAASGLIKENLWSSYLTKGVIVERSGMTSVGLADGTPIDMDHPYVFSDMT    351 - 420
SYFTLLVGIYFPSVTGIMAGSNRSGDLRDAQKSIPTGTILAIATTSAVYISSVVLFGACIEGVVLRDKFG    421 - 490
EAVNGNLVVGTLAWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAISRDGIVPFLQVFGHGKANGEPTWA    491 - 560
LLLTACICEIGILIASLDEVAPILSMFFLMCYMFVNLACAVQTLLRTPNWRPRFRYYHWTLSFLGMSLCL    561 - 630
ALMFICSWYYALVAMLIAGLIYKYIEYRGAEKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQLLVL    631 - 700
VRVDQDQNVVHPQLLSLTSQLKAGKGLTIVGSVLEGTFLENHPQAQRAEESIRRLMEAEKVKGFCQVVIS    701 - 770
SNLRDGVSHLIQSGGLGGLQHNTVLVGWPRNWRQKEDHQTWRNFIELVRETTAGHLALLVTKNVSMFPGN    771 - 840
PERFSEGSIDVWWIVHDGGMLMLLPFLLRHHKVWRKCKMRIFTVAQMDDNSIQMKKDLTTFLYHLRITAE    841 - 910
VEVVEMHESDISAYTYEKTLVMEQRSQILKQMHLTKNEREREIQSITDESRGSIRRKNPANTRLRLNVPE    911 - 980
ETAGDSEEKPEEEVQLIHDQSAPSCPSSSPSPGEEPEGEGETDPEKVHLTWTKDKSVAEKNKGPSPVSSE    981 - 1050
GIKDFFSMKPEWENLNQSNVRRMHTAVRLNEVIVKKSRDAKLVLLNMPGPPRNRNGDENYMEFLEVLTEH   1051 - 1120
LDRVMLVRGGGREVITIYS                                                      1121 - 1139
//

Text Mined References (52)

PMID Year Title