Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.88
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
subependymal giant cell astrocytoma 2287 0.0143208939971197

Expression

  Differential Expression (1)

Disease log2 FC p
subependymal giant cell astrocytoma 1.057 0.014

Synonym

Accession Q9H2X8 Q8TBD7 Q9NYL0
Symbols TLH29
FAM14A
ISG12B

Gene

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid

AA Sequence

MMKRAAAAAVGGALAVGAVPVVLSAMGFTGAGIAASSIAAKMMSAAAIANGGGVSAGSLVATLQSVGAAG      1 - 70
LSTSSNILLASVGSVLGACLGNSPSSSLPAEPEAKEDEARENVPQGEPPKPPLKSEKHEE               71 - 130
//

Text Mined References (4)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15014966 2004 Sequence organization and matrix attachment regions of the human serine protease inhibitor gene cluster at 14q32.1.
14728724 2004 Identification of a novel gene family that includes the interferon-inducible human genes 6-16 and ISG12.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.