Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.88
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
subependymal giant cell astrocytoma 2287 1.4e-02

Expression

  Differential Expression (1)

Disease log2 FC p
subependymal giant cell astrocytoma 1.057 1.4e-02

Synonym

Accession Q9H2X8 Q8TBD7 Q9NYL0
Symbols TLH29
FAM14A
ISG12B

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MMKRAAAAAVGGALAVGAVPVVLSAMGFTGAGIAASSIAAKMMSAAAIANGGGVSAGSLVATLQSVGAAG      1 - 70
LSTSSNILLASVGSVLGACLGNSPSSSLPAEPEAKEDEARENVPQGEPPKPPLKSEKHEE               71 - 130
//

Text Mined References (4)

PMID Year Title