Property Summary

NCBI Gene PubMed Count 132
Grant Count 41
R01 Count 29
Funding $3,505,205.34
PubMed Score 125.07
PubTator Score 125.03

Knowledge Summary

Patent (5,210)

Expression

  Differential Expression (21)

Gene RIF (104)

PMID Text
26633710 Results indicate that Hipk2 exerts a relevant role in the survival of cerebellar Purkinje cells and that Hipk2 genetic ablation generates cerebellar dysfunction compatible with an ataxic-like phenotype.
26247811 The findings highlight a complex regulation of CREB-binding protein activity by HIPK2, which might be relevant for the control of specific sets of target genes involved in cellular proliferation, differentiation and apoptosis.
26113041 Our findings indicate that phosphorylation-dependent restriction of SIRT1 activity by HIPK2 shapes the p53 response
26102034 Lafora disease proteins laforin and malin negatively regulate the HIPK2-p53 cell death pathway.
25961923 MDM4/HIPK2/p53 cytoplasmic assembly uncovers coordinated repression of molecules with anti-apoptotic activity during early DNA damage response.
25944899 c-Abl was required for endogenous HIPK2 accumulation and phosphorylation of p53 at Ser46 in response to DNA damage by gamma- and UV radiation.
25868975 Results indicate that HIPK2 acts as a caretaker gene, whose inactivation increases tumorigenicity and causes chromosomal instability by cytokinesis failure.
25820028 This work describes a novel mechanism of translational suppression by Pdcd4 and shows for the first time that Hipk2 controls its own synthesis by an auto-regulatory feedback mechanism.
25778922 Ras induces the formation of a complex between NORE1A and the kinase HIPK2, enhancing HIPK2 association with p53.
25711204 HIPK2 expression tends to be decreased along tumor progression and may be involved with the invasive potential, suggesting a possible tumor suppressor role for HIPK2.
More...

AA Sequence

MAPVYEGMASHVQVFSPHTLQSSAFCSVKKLKIEPSSNWDMTGYGSHSKVYSQSKNIPLSQPATTTVSTS      1 - 70
LPVPNPSLPYEQTIVFPGSTGHIVVTSASSTSVTGQVLGGPHNLMRRSTVSLLDTYQKCGLKRKSEEIEN     71 - 140
TSSVQIIEEHPPMIQNNASGATVATATTSTATSKNSGSNSEGDYQLVQHEVLCSMTNTYEVLEFLGRGTF    141 - 210
GQVVKCWKRGTNEIVAIKILKNHPSYARQGQIEVSILARLSTESADDYNFVRAYECFQHKNHTCLVFEML    211 - 280
EQNLYDFLKQNKFSPLPLKYIRPVLQQVATALMKLKSLGLIHADLKPENIMLVDPSRQPYRVKVIDFGSA    281 - 350
SHVSKAVCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLP    351 - 420
AEYLLSAGTKTTRFFNRDTDSPYPLWRLKTPDDHEAETGIKSKEARKYIFNCLDDMAQVNMTTDLEGSDM    421 - 490
LVEKADRREFIDLLKKMLTIDADKRITPIETLNHPFVTMTHLLDFPHSTHVKSCFQNMEICKRRVNMYDT    491 - 560
VNQSKTPFITHVAPSTSTNLTMTFNNQLTTVHNQAPSSTSATISLANPEVSILNYPSTLYQPSAASMAAV    561 - 630
AQRSMPLQTGTAQICARPDPFQQALIVCPPGFQGLQASPSKHAGYSVRMENAVPIVTQAPGAQPLQIQPG    631 - 700
LLAQQAWPSGTQQILLPPAWQQLTGVATHTSVQHATVIPETMAGTQQLADWRNTHAHGSHYNPIMQQPAL    701 - 770
LTGHVTLPAAQPLNVGVAHVMRQQPTSTTSSRKSKQHQSSVRNVSTCEVSSSQAISSPQRSKRVKENTPP    771 - 840
RCAMVHSSPACSTSVTCGWGDVASSTTRERQRQTIVIPDTPSPTVSVITISSDTDEEEEQKHAPTSTVSK    841 - 910
QRKNVISCVTVHDSPYSDSSSNTSPYSVQQRAGHNNANAFDTKGSLENHCTGNPRTIIVPPLKTQASEVL    911 - 980
VECDSLVPVNTSHHSSSYKSKSSSNVTSTSGHSSGSSSGAITYRQQRPGPHFQQQQPLNLSQAQQHITTD    981 - 1050
RTGSHRRQQAYITPTMAQAPYSFPHNSPSHGTVHPHLAAAAAAAHLPTQPHLYTYTAPAALGSTGTVAHL   1051 - 1120
VASQGSARHTVQHTAYPASIVHQVPVSMGPRVLPSPTIHPSQYPAQFAHQTYISASPASTVYTGYPLSPA   1121 - 1190
KVNQYPYI                                                                 1191 - 1198
//

Text Mined References (142)

PMID Year Title
26633710 2015 Genetic ablation of homeodomain-interacting protein kinase 2 selectively induces apoptosis of cerebellar Purkinje cells during adulthood and generates an ataxic-like phenotype.
26247811 2015 Complex regulation of CREB-binding protein by homeodomain-interacting protein kinase 2.
26113041 2016 HIPK2 restricts SIRT1 activity upon severe DNA damage by a phosphorylation-controlled mechanism.
26102034 2015 Lafora disease proteins laforin and malin negatively regulate the HIPK2-p53 cell death pathway.
25961923 2016 MDM4/HIPK2/p53 cytoplasmic assembly uncovers coordinated repression of molecules with anti-apoptotic activity during early DNA damage response.
25944899 2015 The Tyrosine Kinase c-Abl Promotes Homeodomain-interacting Protein Kinase 2 (HIPK2) Accumulation and Activation in Response to DNA Damage.
25868975 2015 HIPK2 deficiency causes chromosomal instability by cytokinesis failure and increases tumorigenicity.
25820028 2015 Programmed cell death 4 protein (Pdcd4) and homeodomain-interacting protein kinase 2 (Hipk2) antagonistically control translation of Hipk2 mRNA.
25778922 2015 NORE1A is a Ras senescence effector that controls the apoptotic/senescent balance of p53 via HIPK2.
25711204 2015 HIPK2 expression in progression of cutaneous epithelial neoplasm.
More...