Property Summary

Ligand Count 3
NCBI Gene PubMed Count 140
PubMed Score 135.37
PubTator Score 125.03

Knowledge Summary

Patent (5,210)

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma -1.400 7.3e-04
astrocytic glioma 1.700 1.3e-02
atypical teratoid / rhabdoid tumor -1.100 2.1e-03
Down syndrome 1.400 6.0e-03
gastric cancer 1.100 5.8e-04
glioblastoma 1.400 1.2e-03
group 3 medulloblastoma -1.100 3.5e-02
hereditary spastic paraplegia -1.047 2.7e-02
intraductal papillary-mucinous adenoma (... 1.200 7.5e-03
invasive ductal carcinoma -1.100 4.2e-03
malignant mesothelioma -1.900 1.9e-06
medulloblastoma, large-cell -2.000 8.1e-04
oligodendroglioma 1.300 2.9e-02
osteosarcoma 2.428 2.1e-08
ovarian cancer -1.700 2.3e-04
Pick disease 1.400 1.6e-04
pituitary cancer -1.100 2.2e-03
psoriasis 1.400 9.8e-04
Rheumatoid arthritis 2.000 4.3e-03
subependymal giant cell astrocytoma -1.400 4.7e-02
tuberculosis and treatment for 6 months -1.200 8.4e-03

Protein-protein Interaction (3)

Gene RIF (111)

AA Sequence

MAPVYEGMASHVQVFSPHTLQSSAFCSVKKLKIEPSSNWDMTGYGSHSKVYSQSKNIPLSQPATTTVSTS      1 - 70
LPVPNPSLPYEQTIVFPGSTGHIVVTSASSTSVTGQVLGGPHNLMRRSTVSLLDTYQKCGLKRKSEEIEN     71 - 140
TSSVQIIEEHPPMIQNNASGATVATATTSTATSKNSGSNSEGDYQLVQHEVLCSMTNTYEVLEFLGRGTF    141 - 210
GQVVKCWKRGTNEIVAIKILKNHPSYARQGQIEVSILARLSTESADDYNFVRAYECFQHKNHTCLVFEML    211 - 280
EQNLYDFLKQNKFSPLPLKYIRPVLQQVATALMKLKSLGLIHADLKPENIMLVDPSRQPYRVKVIDFGSA    281 - 350
SHVSKAVCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLP    351 - 420
AEYLLSAGTKTTRFFNRDTDSPYPLWRLKTPDDHEAETGIKSKEARKYIFNCLDDMAQVNMTTDLEGSDM    421 - 490
LVEKADRREFIDLLKKMLTIDADKRITPIETLNHPFVTMTHLLDFPHSTHVKSCFQNMEICKRRVNMYDT    491 - 560
VNQSKTPFITHVAPSTSTNLTMTFNNQLTTVHNQAPSSTSATISLANPEVSILNYPSTLYQPSAASMAAV    561 - 630
AQRSMPLQTGTAQICARPDPFQQALIVCPPGFQGLQASPSKHAGYSVRMENAVPIVTQAPGAQPLQIQPG    631 - 700
LLAQQAWPSGTQQILLPPAWQQLTGVATHTSVQHATVIPETMAGTQQLADWRNTHAHGSHYNPIMQQPAL    701 - 770
LTGHVTLPAAQPLNVGVAHVMRQQPTSTTSSRKSKQHQSSVRNVSTCEVSSSQAISSPQRSKRVKENTPP    771 - 840
RCAMVHSSPACSTSVTCGWGDVASSTTRERQRQTIVIPDTPSPTVSVITISSDTDEEEEQKHAPTSTVSK    841 - 910
QRKNVISCVTVHDSPYSDSSSNTSPYSVQQRAGHNNANAFDTKGSLENHCTGNPRTIIVPPLKTQASEVL    911 - 980
VECDSLVPVNTSHHSSSYKSKSSSNVTSTSGHSSGSSSGAITYRQQRPGPHFQQQQPLNLSQAQQHITTD    981 - 1050
RTGSHRRQQAYITPTMAQAPYSFPHNSPSHGTVHPHLAAAAAAAHLPTQPHLYTYTAPAALGSTGTVAHL   1051 - 1120
VASQGSARHTVQHTAYPASIVHQVPVSMGPRVLPSPTIHPSQYPAQFAHQTYISASPASTVYTGYPLSPA   1121 - 1190
KVNQYPYI                                                                 1191 - 1198
//

Text Mined References (151)

PMID Year Title