Property Summary

NCBI Gene PubMed Count 88
PubMed Score 96.13
PubTator Score 136.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Expression

  Differential Expression (4)

Synonym

Accession Q9H2X3 A6NKI4 A8K8B3 Q69F40 Q969M4 Q96QP3 Q96QP4 Q96QP5 Q96QP6 Q9BXS3 Q9H2Q9 Q9H8F0 Q9Y2A8
Symbols CD299
LSIGN
CD209L
L-SIGN
DCSIGNR
HP10347
DC-SIGN2
DC-SIGNR

Gene

PDB

1K9J   1SL6   1XAR   1XPH   1Z0Y   3JQH  

  Ortholog (2)

Species Source
Chimp OMA EggNOG Inparanoid
Mouse OMA Inparanoid

Gene RIF (96)

PMID Text
26313015 DC-SIGNR expression in peripheral blood mononuclear cells was higher in HIV-1-infected patients, and its positive correlation with viral load and negative with CD4+ T cells counts suggest a potential role of DC-SIGNR in HIV-1 infection.
26150177 Study demonstrated that serum levels of DC-SIGNR in lung cancer patients were significantly lower than those in healthy individuals, and correlated significantly with brain metastasis and serum NK cells percentage.
25832887 Genetic variations in STXBP5 and CLEC4M are associated with VWF level variation in type 1, but not in type 2 von Willebrand disease.
25656622 CD209L variation may influence susceptibility to HIV-1, response to treatment, and disease progression.
25504222 DC-SIGN and DC-SIGNR are blood-based molecular markers that can potentially be used for the diagnosis of early stage patients
24976257 The CLEC4M carbohydrate recognition domain rapidly and reversibly releases glycan ligands and Ca(2+) at reduced pH.
24965233 CLEC4M and CD81 both are still crucial for hepatitis C virus entry into hepatocytes.
24874302 of an association between CD209 and CD209L polymorphisms and tuberculosis development in a Brazilian population
24623090 Japanese encephalitis virus infected cells through three virus receptors: DC-SIGN, DC-SIGNR and LSECtin.
24283933 The results indicate that neck region polymorphism of L-SIGN can influence the outcome of HCV infection and the four-tandem repeat is associated with clearance of HCV infection.
More...

AA Sequence

MSDSKEPRVQQLGLLEEDPTTSGIRLFPRDFQFQQIHGHKSSTGCLGHGALVLQLLSFMLLAGVLVAILV      1 - 70
QVSKVPSSLSQEQSEQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELT     71 - 140
RLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTE    141 - 210
LKAAVGELPEKSKLQEIYQELTQLKAAVGELPDQSKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNCY    211 - 280
FMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPS    281 - 350
FQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFRDE                         351 - 399
//

Text Mined References (95)

PMID Year Title
26313015 2015 Association of DC-SIGNR Expression in Peripheral Blood Mononuclear Cells with DC-SIGNR Genotypes in HIV-1 Infection.
26150177 2015 Low expression of dendritic cell-specific intercellular adhesion molecule-grabbing nonintegrin-related protein in lung cancer and significant correlations with brain metastasis and natural killer cells.
25832887 2015 CLEC4M and STXBP5 gene variations contribute to von Willebrand factor level variation in von Willebrand disease.
25656622 2015 Association of CD209L tandem repeats polymorphism with susceptibility to human immunodeficiency virus-1 infection, disease progression, and treatment outcomes: a Moroccan cohort study.
25504222 2014 The clinical significance of DC-SIGN and DC-SIGNR, which are novel markers expressed in human colon cancer.
24976257 2014 NMR evidence for oligosaccharide release from the dendritic-cell specific intercellular adhesion molecule 3-grabbing non-integrin-related (CLEC4M) carbohydrate recognition domain at low pH.
24965233 2014 CLEC4M-positive and CD81-negative Huh7 cells are not susceptible to JFH-1 HCVcc infection but mediate transinfection.
24874302 2014 Association of CD209 and CD209L polymorphisms with tuberculosis infection in a Northeastern Brazilian population.
24623090 2014 Distinct usage of three C-type lectins by Japanese encephalitis virus: DC-SIGN, DC-SIGNR, and LSECtin.
24283933 2014 The allele 4 of neck region liver-lymph node-specific ICAM-3-grabbing integrin variant is associated with spontaneous clearance of hepatitis C virus and decrease of viral loads.
More...