Property Summary

NCBI Gene PubMed Count 29
Grant Count 152
R01 Count 112
Funding $17,296,618.33
PubMed Score 194.43
PubTator Score 56.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
ependymoma -1.200 0.000
atypical teratoid / rhabdoid tumor -1.200 0.000
medulloblastoma, large-cell -1.200 0.001
intraductal papillary-mucinous neoplasm ... -1.100 0.003
group 3 medulloblastoma -1.400 0.014
Breast cancer 1.500 0.000

Gene

Gene RIF (11)

PMID Text
26517884 Data suggest CHRD (chordin) cleavage by tolloid-like metalloproteinases is insufficient to regulate BMP(bone morphogenetic protein)/BMPR signaling; CHRD fragments and TSG (twisted gastrulation protein) contribute to inhibition of BMP/BMPR signaling.
25157165 C-terminal chordin domains play an important role in Bone morphogenetic protein regulation.
23931154 chordin silencing increased osteogenic differentiation without supplemented BMP-2.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
19058174 there was no difference in the expression of the noggin and chordin between healing and nonhealing fractures
19023570 Noggin and chordin were also expressed most intensely in areas of cartilage formation and there was no difference in their expression between the non-hypertrophic and hypertrophic chondrocytes.
18533030 Bone morphogenetic protein (BMP) chordin is produced endogenously during osteogenic differentiation of human mesenchymal stem cells (MSCs); blockade of bone morphogenetic inhibitor chordin increases the rate of osteogenic differentiation of MSCs in vitro.
16449796 results suggest that CHRD could participate in regulating BMP activity in normal ovarian surface epithelium physiology, and that its mis-expression in ovarian surface epithelium may facilitate cancer incidence and/or progression
More...

AA Sequence

MPSLPAPPAPLLLLGLLLLGSRPARGAGPEPPVLPIRSEKEPLPVRGAAGCTFGGKVYALDETWHPDLGE      1 - 70
PFGVMRCVLCACEAPQWGRRTRGPGRVSCKNIKPECPTPACGQPRQLPGHCCQTCPQERSSSERQPSGLS     71 - 140
FEYPRDPEHRSYSDRGEPGAEERARGDGHTDFVALLTGPRSQAVARARVSLLRSSLRFSISYRRLDRPTR    141 - 210
IRFSDSNGSVLFEHPAAPTQDGLVCGVWRAVPRLSLRLLRAEQLHVALVTLTHPSGEVWGPLIRHRALAA    211 - 280
ETFSAILTLEGPPQQGVGGITLLTLSDTEDSLHFLLLFRGLLEPRSGGLTQVPLRLQILHQGQLLRELQA    281 - 350
NVSAQEPGFAEVLPNLTVQEMDWLVLGELQMALEWAGRPGLRISGHIAARKSCDVLQSVLCGADALIPVQ    351 - 420
TGAAGSASLTLLGNGSLIYQVQVVGTSSEVVAMTLETKPQRRDQRTVLCHMAGLQPGGHTAVGICPGLGA    421 - 490
RGAHMLLQNELFLNVGTKDFPDGELRGHVAALPYCGHSARHDTLPVPLAGALVLPPVKSQAAGHAWLSLD    491 - 560
THCHLHYEVLLAGLGGSEQGTVTAHLLGPPGTPGPRRLLKGFYGSEAQGVVKDLEPELLRHLAKGMASLM    561 - 630
ITTKGSPRGELRGQVHIANQCEVGGLRLEAAGAEGVRALGAPDTASAAPPVVPGLPALAPAKPGGPGRPR    631 - 700
DPNTCFFEGQQRPHGARWAPNYDPLCSLCTCQRRTVICDPVVCPPPSCPHPVQAPDQCCPVCPEKQDVRD    701 - 770
LPGLPRSRDPGEGCYFDGDRSWRAAGTRWHPVVPPFGLIKCAVCTCKGGTGEVHCEKVQCPRLACAQPVR    771 - 840
VNPTDCCKQCPVGSGAHPQLGDPMQADGPRGCRFAGQWFPESQSWHPSVPPFGEMSCITCRCGAGVPHCE    841 - 910
RDDCSLPLSCGSGKESRCCSRCTAHRRPAPETRTDPELEKEAEGS                             911 - 955
//

Text Mined References (29)

PMID Year Title
26517884 2015 The role of chordin fragments generated by partial tolloid cleavage in regulating BMP activity.
25416956 2014 A proteome-scale map of the human interactome network.
25157165 2014 Nanoscale structure of the BMP antagonist chordin supports cooperative BMP binding.
23931154 2014 Gene silencing of chordin improves BMP-2 effects on osteogenic differentiation of human adipose tissue-derived stromal cells.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19058174 2009 Altered relative expression of BMPs and BMP inhibitors in cartilaginous areas of human fractures progressing towards nonunion.
More...