Property Summary

NCBI Gene PubMed Count 8
PubMed Score 560.53
PubTator Score 115.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
facioscapulohumeral dystrophy 288 1.4e-02
Disease Target Count Z-score Confidence
Dementia 175 3.485 1.7
Milk allergy 3 3.384 1.7
Uterine inversion 5 3.351 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
facioscapulohumeral dystrophy 1.900 1.4e-02

Gene RIF (9)

AA Sequence

MATAESRALQFAEGAAFPAYRAPHAGGALLPPPSPAAALLPAPPAGPGPATFAGFLGRDPGPAPPPPASL      1 - 70
GSPAPPKGAAAPSASQRRKRTSFSAEQLQLLELVFRRTRYPDIHLRERLAALTLLPESRIQVWFQNRRAK     71 - 140
SRRQSGKSFQPLARPEIILNHCAPGTETKCLKPQLPLEVDVNCLPEPNGVGGGISDSSSQGQNFETCSPL    141 - 210
SEDIGSKLDSWEEHIFSAFGNF                                                    211 - 232
//

Text Mined References (14)

PMID Year Title