Property Summary

NCBI Gene PubMed Count 8
Grant Count 37
R01 Count 17
Funding $8,428,295.3
PubMed Score 524.83
PubTator Score 115.29

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
facioscapulohumeral dystrophy 1.900 0.014

 GO Component (1)

Gene RIF (9)

PMID Text
25544748 Findings support the existence of a novel MIXL1-c REL mediated survival axis in AML that can be targeted by BMPR1 inhibitors. (MIXL1- human gene, Mixl1- mouse ortholog, MIXL1- protein).
25521758 results demonstrate that Mixl1 and Flk1 play roles...during dimethyl sulfoxide-induced mesodermal specification in P19 cells.
22632162 Both HIV-1 Tat 47-59 and FITC-labeled Tat 47-59 peptides downregulate gene expression of Mix paired-like homeobox (MIXL1) in U-937 macrophages
22164283 Brachyury and related Tbx proteins interact with the Mixl1 homeodomain protein and negatively regulate Mixl1 transcriptional activity
18976975 Knockdown of Mix paired-like homeobox (MIXL1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18032708 Targeted insertion in human embryonic stem cells of sequences encoding green fluorescent protein (GFP) into the locus of MIXL1, a gene transiently expressed in the primitive streak during embryogenesis.
17303500 MIXL1 protein is differentially expressed in non-Hodgkin lymphoma and Hodgkin lymphoma; findings suggest that MIXL1 overexpression may play a role in driving proliferatin or blocking differentiation in lymphoma oncogenesis
15982639 These results demonstrate for a functional role for TGF-beta ligands in regulation of mammalian Mixl1, identify FoxH1 as an essential co-activator, and implicate Nodal as the embryonic regulator of Mixl1 in mesendoderm morphogenesis.
12070013 shows functional similarity to Xenopus Mix.1

AA Sequence

MATAESRALQFAEGAAFPAYRAPHAGGALLPPPSPAAALLPAPPAGPGPATFAGFLGRDPGPAPPPPASL      1 - 70
GSPAPPKGAAAPSASQRRKRTSFSAEQLQLLELVFRRTRYPDIHLRERLAALTLLPESRIQVWFQNRRAK     71 - 140
SRRQSGKSFQPLARPEIILNHCAPGTETKCLKPQLPLEVDVNCLPEPNGVGGGISDSSSQGQNFETCSPL    141 - 210
SEDIGSKLDSWEEHIFSAFGNF                                                    211 - 232
//

Text Mined References (14)

PMID Year Title
25544748 2014 A role for BMP-induced homeobox gene MIXL1 in acute myelogenous leukemia and identification of type I BMP receptor as a potential target for therapy.
25521758 2015 Mixl1 and Flk1 Are Key Players of Wnt/TGF-? Signaling During DMSO-Induced Mesodermal Specification in P19 cells.
22164283 2011 Brachyury and related Tbx proteins interact with the Mixl1 homeodomain protein and negatively regulate Mixl1 transcriptional activity.
18032708 2008 Targeting a GFP reporter gene to the MIXL1 locus of human embryonic stem cells identifies human primitive streak-like cells and enables isolation of primitive hematopoietic precursors.
17303500 2007 Differential expression of the human MIXL1 gene product in non-Hodgkin and Hodgkin lymphomas.
17224082 2006 Amino terminal tyrosine phosphorylation of human MIXL1.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16433620 2005 Mixl1 and oct4 proteins are transiently co-expressed in differentiating mouse and human embryonic stem cells.
15982639 2005 Transcriptional regulation of the homeobox gene Mixl1 by TGF-beta and FoxH1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...