Property Summary

NCBI Gene PubMed Count 15
PubMed Score 7.43
PubTator Score 7.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung carcinoma 2844 9.60195628987298E-18
non-small cell lung cancer 2798 2.93031461940492E-12
Duchenne muscular dystrophy 602 1.241930416168E-9
juvenile dermatomyositis 1189 6.22060721124084E-9
ovarian cancer 8492 6.77789722252194E-8
pilocytic astrocytoma 3086 6.86150823847394E-8
tuberculosis 1563 5.49587789219112E-7
primary Sjogren syndrome 789 2.92507220564567E-5
posterior fossa group A ependymoma 1511 7.89983897846324E-5
glioblastoma 5572 8.33447293994715E-5
invasive ductal carcinoma 2950 1.43039940549113E-4
hepatocellular carcinoma 550 1.79691249437073E-4
adrenocortical carcinoma 1427 2.02347443855889E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 3.07149651405096E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 4.06974280842306E-4
chronic lymphosyte leukemia 232 5.22578552894653E-4
lung cancer 4473 5.5419636236949E-4
interstitial cystitis 2299 6.42919675144964E-4
adult high grade glioma 2148 0.00106824963171884
head and neck cancer and chronic obstructive pulmonary disease 237 0.00124845921880408
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00125807879969343
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00162150682781203
osteosarcoma 7933 0.00255774928472763
cutaneous lupus erythematosus 1056 0.00302403484031358
sonic hedgehog group medulloblastoma 1482 0.00345773630065132
subependymal giant cell astrocytoma 2287 0.0105804140639447
mucosa-associated lymphoid tissue lymphoma 480 0.0403351949245378
astrocytoma 1493 0.0498690860773271
Disease Target Count Z-score Confidence
Alzheimer's disease 644 4.217 2.1

Expression

Gene RIF (6)

PMID Text
24064185 high levels of MS4A6A contribute to altered turnover or production of cells with an anti-inflammatory neuroprotective phenotype in favor of cells with a damaging pro-inflammatory phenotype believed to contribute to AD pathology.
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of membrane-spanning 4-domains, subfamily A, member 6A (MS4A6A) in peptide-treated PBMCs
22382309 data revealed the allele (T) of the rs3865444 polymorphism of the CD33 gene and the allele (C) of the rs610932 polymorphism of the MS4A6A gene may contribute to Alzheimer's disease risk in the Chinese Han population
21460840 ABCA7 and the MS4A6A/MS4A4E gene cluster are new Alzheimer's disease susceptibility loci.
20453000 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MTSQPVPNETIIVLPSNVINFSQAEKPEPTNQGQDSLKKHLHAEIKVIGTIQILCGMMVLSLGIILASAS      1 - 70
FSPNFTQVTSTLLNSAYPFIGPFFFIISGSLSIATEKRLTKLLVHSSLVGSILSALSALVGFIILSVKQA     71 - 140
TLNPASLQCELDKNNIPTRSYVSYFYHDSLYTTDCYTAKASLAGTLSLMLICTLLEFCLAVLTAVLRWKQ    141 - 210
AYSDFPGSVLFLPHSYIGNSGMSSKMTHDCGYEELLTS                                    211 - 248
//

Text Mined References (17)

PMID Year Title
24162737 2013 Meta-analysis of 74,046 individuals identifies 11 new susceptibility loci for Alzheimer's disease.
24064185 2014 Alzheimer's disease susceptibility variants in the MS4A6A gene are associated with altered levels of MS4A6A expression in blood.
23969696 2013 Multiethnic meta-analysis of genome-wide association studies in >100 000 subjects identifies 23 fibrinogen-associated Loci but no strong evidence of a causal association between circulating fibrinogen and cardiovascular disease.
22382309 2012 The prevalence of CD33 and MS4A6A variant in Chinese Han population with Alzheimer's disease.
21460840 2011 Common variants at ABCA7, MS4A6A/MS4A4E, EPHA1, CD33 and CD2AP are associated with Alzheimer's disease.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...