Property Summary

NCBI Gene PubMed Count 19
PubMed Score 8.22
PubTator Score 7.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Glomerulonephritis, IGA 34 0.0 0.0
Disease Target Count
IGA Glomerulonephritis 50
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Alzheimer's disease 658 4.336 2.2
Disease Target Count Z-score Confidence
Normal pressure hydrocephalus 11 3.254 1.6

Expression

Gene RIF (10)

AA Sequence

MTSQPVPNETIIVLPSNVINFSQAEKPEPTNQGQDSLKKHLHAEIKVIGTIQILCGMMVLSLGIILASAS      1 - 70
FSPNFTQVTSTLLNSAYPFIGPFFFIISGSLSIATEKRLTKLLVHSSLVGSILSALSALVGFIILSVKQA     71 - 140
TLNPASLQCELDKNNIPTRSYVSYFYHDSLYTTDCYTAKASLAGTLSLMLICTLLEFCLAVLTAVLRWKQ    141 - 210
AYSDFPGSVLFLPHSYIGNSGMSSKMTHDCGYEELLTS                                    211 - 248
//

Text Mined References (21)

PMID Year Title