Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Keratoconus 113 3.83 1.9

Synonym

Accession Q9H2U6 Q3SY27 Q9UMC1
Symbols C15orf5

 Compartment GO Term (0)

AA Sequence

MLKNRELLKIFEQASHMMKLIEEHCICDCIWMEWEDLEAKTLDRRPPEQTRRERCSCGNGKRWAKPKITT      1 - 70
EKKNHPDFMIDWMYFETPLSIQMK                                                   71 - 94
//

Text Mined References (4)

PMID Year Title