Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Keratoconus 47 3.845 1.9

Synonym

Accession Q9H2U6 Q3SY27 Q9UMC1
Symbols C15orf5

Gene

 Compartment GO Term (0)

AA Sequence

MLKNRELLKIFEQASHMMKLIEEHCICDCIWMEWEDLEAKTLDRRPPEQTRRERCSCGNGKRWAKPKITT      1 - 70
EKKNHPDFMIDWMYFETPLSIQMK                                                   71 - 94
//

Text Mined References (4)

PMID Year Title
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11697146 2001 Identification of C15orf5, a heart-enriched transcript on chromosome 15q23-q24.