Property Summary

NCBI Gene PubMed Count 21
PubMed Score 22.05
PubTator Score 14.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 1.605532884395E-7
group 4 medulloblastoma 1875 8.21359485880085E-4
osteosarcoma 7933 0.00973599255033119
non primary Sjogren syndrome sicca 840 0.0177036150523076
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0295245513060744
Disease Target Count Z-score Confidence
Multiple Sclerosis 498 0.0 2.0

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 1.313 0.010
intraductal papillary-mucinous neoplasm ... 1.100 0.030
group 4 medulloblastoma -1.100 0.001
non primary Sjogren syndrome sicca 1.300 0.018
ovarian cancer -1.700 0.000

Synonym

Accession Q9H2U2 B4DLP7 F8WDN9 I6L9B6 Q4W5E9 Q6PG51 Q8TBW0 Q96E55 Q9H0T0 Q9NX37 Q9P033 Q9ULX0
Symbols SCFI
SCFAI
HSPC124
SID6-306

Gene

PANTHER Protein Class (2)

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
S.cerevisiae OMA Inparanoid

Gene RIF (6)

PMID Text
23241943 Single nucleotide polymorphisms in PPA2 is associated with response to antipsychotic agents in schizophrenia.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20332099 Observational study of gene-disease association. (HuGE Navigator)
19067239 We think that PP2A can be one of the key components to regulate the fusion of various endocytotic compartments and /or the trafficking along the microtubules.
16300924 No pathogenic mutations were identified in the PPA2 gene in patients with mitochondrial DNA depletion syndromes (MDS).

AA Sequence

MSALLRLLRTGAPAAACLRLGTSAGTGSRRAMALYHTEERGQPCSQNYRLFFKNVTGHYISPFHDIPLKV      1 - 70
NSKEENGIPMKKARNDEYENLFNMIVEIPRWTNAKMEIATKEPMNPIKQYVKDGKLRYVANIFPYKGYIW     71 - 140
NYGTLPQTWEDPHEKDKSTNCFGDNDPIDVCEIGSKILSCGEVIHVKILGILALIDEGETDWKLIAINAN    141 - 210
DPEASKFHDIDDVKKFKPGYLEATLNWFRLYKVPDGKPENQFAFNGEFKNKAFALEVIKSTHQCWKALLM    211 - 280
KKCNGGAINCTNVQISDSPFRCTQEEARSLVESVSSSPNKESNEEEQVWHFLGK                    281 - 334
//

Text Mined References (31)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23241943 2013 Genome-wide association study of patient-rated and clinician-rated global impression of severity during antipsychotic treatment.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658931 2012 A genome-wide association study of host genetic determinants of the antibody response to Anthrax Vaccine Adsorbed.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...