Property Summary

NCBI Gene PubMed Count 21
Grant Count 6
R01 Count 4
Funding $586,778.8
PubMed Score 22.05
PubTator Score 14.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 1.313 0.010
intraductal papillary-mucinous neoplasm ... 1.100 0.030
group 4 medulloblastoma -1.100 0.001
non primary Sjogren syndrome sicca 1.300 0.018
ovarian cancer -1.700 0.000

Gene RIF (6)

PMID Text
23241943 Single nucleotide polymorphisms in PPA2 is associated with response to antipsychotic agents in schizophrenia.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20332099 Observational study of gene-disease association. (HuGE Navigator)
19067239 We think that PP2A can be one of the key components to regulate the fusion of various endocytotic compartments and /or the trafficking along the microtubules.
16300924 No pathogenic mutations were identified in the PPA2 gene in patients with mitochondrial DNA depletion syndromes (MDS).

AA Sequence

MSALLRLLRTGAPAAACLRLGTSAGTGSRRAMALYHTEERGQPCSQNYRLFFKNVTGHYISPFHDIPLKV      1 - 70
NSKEENGIPMKKARNDEYENLFNMIVEIPRWTNAKMEIATKEPMNPIKQYVKDGKLRYVANIFPYKGYIW     71 - 140
NYGTLPQTWEDPHEKDKSTNCFGDNDPIDVCEIGSKILSCGEVIHVKILGILALIDEGETDWKLIAINAN    141 - 210
DPEASKFHDIDDVKKFKPGYLEATLNWFRLYKVPDGKPENQFAFNGEFKNKAFALEVIKSTHQCWKALLM    211 - 280
KKCNGGAINCTNVQISDSPFRCTQEEARSLVESVSSSPNKESNEEEQVWHFLGK                    281 - 334
//

Text Mined References (31)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23241943 2013 Genome-wide association study of patient-rated and clinician-rated global impression of severity during antipsychotic treatment.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658931 2012 A genome-wide association study of host genetic determinants of the antibody response to Anthrax Vaccine Adsorbed.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...