Property Summary

NCBI Gene PubMed Count 23
PubMed Score 21.38
PubTator Score 14.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (5)

Disease log2 FC p
group 4 medulloblastoma -1.100 8.2e-04
intraductal papillary-mucinous neoplasm ... 1.100 3.0e-02
non primary Sjogren syndrome sicca 1.300 1.8e-02
osteosarcoma -1.270 2.5e-04
ovarian cancer -1.700 1.6e-07

Protein-protein Interaction (10)

Gene RIF (8)

AA Sequence

MSALLRLLRTGAPAAACLRLGTSAGTGSRRAMALYHTEERGQPCSQNYRLFFKNVTGHYISPFHDIPLKV      1 - 70
NSKEENGIPMKKARNDEYENLFNMIVEIPRWTNAKMEIATKEPMNPIKQYVKDGKLRYVANIFPYKGYIW     71 - 140
NYGTLPQTWEDPHEKDKSTNCFGDNDPIDVCEIGSKILSCGEVIHVKILGILALIDEGETDWKLIAINAN    141 - 210
DPEASKFHDIDDVKKFKPGYLEATLNWFRLYKVPDGKPENQFAFNGEFKNKAFALEVIKSTHQCWKALLM    211 - 280
KKCNGGAINCTNVQISDSPFRCTQEEARSLVESVSSSPNKESNEEEQVWHFLGK                    281 - 334
//

Text Mined References (33)

PMID Year Title