Property Summary

NCBI Gene PubMed Count 32
PubMed Score 37.39
PubTator Score 29.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
acute quadriplegic myopathy 1.089 9.8e-05
astrocytic glioma 1.300 1.1e-02
ependymoma 1.200 2.0e-02
juvenile dermatomyositis 1.003 1.8e-09
oligodendroglioma 1.300 1.3e-02
osteosarcoma 1.462 2.1e-06
ovarian cancer -1.500 5.0e-06
pancreatic cancer 1.800 6.1e-03
permanent atrial fibrillation -1.100 7.2e-03
pituitary cancer -1.400 1.9e-04
primary pancreatic ductal adenocarcinoma 1.854 2.0e-03

 GWAS Trait (1)

Gene RIF (16)

AA Sequence

MSYDYHQNWGRDGGPRSSGGGYGGGPAGGHGGNRGSGGGGGGGGGGRGGRGRHPGHLKGREIGMWYAKKQ      1 - 70
GQKNKEAERQERAVVHMDERREEQIVQLLNSVQAKNDKESEAQISWFAPEDHGYGTEVSTKNTPCSENKL     71 - 140
DIQEKKLINQEKKMFRIRNRSYIDRDSEYLLQENEPDGTLDQKLLEDLQKKKNDLRYIEMQHFREKLPSY    141 - 210
GMQKELVNLIDNHQVTVISGETGCGKTTQVTQFILDNYIERGKGSACRIVCTQPRRISAISVAERVAAER    211 - 280
AESCGSGNSTGYQIRLQSRLPRKQGSILYCTTGIILQWLQSDPYLSSVSHIVLDEIHERNLQSDVLMTVV    281 - 350
KDLLNFRSDLKVILMSATLNAEKFSEYFGNCPMIHIPGFTFPVVEYLLEDVIEKIRYVPEQKEHRSQFKR    351 - 420
GFMQGHVNRQEKEEKEAIYKERWPDYVRELRRRYSASTVDVIEMMEDDKVDLNLIVALIRYIVLEEEDGA    421 - 490
ILVFLPGWDNISTLHDLLMSQVMFKSDKFLIIPLHSLMPTVNQTQVFKRTPPGVRKIVIATNIAETSITI    491 - 560
DDVVYVIDGGKIKETHFDTQNNISTMSAEWVSKANAKQRKGRAGRVQPGHCYHLYNGLRASLLDDYQLPE    561 - 630
ILRTPLEELCLQIKILRLGGIAYFLSRLMDPPSNEAVLLSIRHLMELNALDKQEELTPLGVHLARLPVEP    631 - 700
HIGKMILFGALFCCLDPVLTIAASLSFKDPFVIPLGKEKIADARRKELAKDTRSDHLTVVNAFEGWEEAR    701 - 770
RRGFRYEKDYCWEYFLSSNTLQMLHNMKGQFAEHLLGAGFVSSRNPKDPESNINSDNEKIIKAVICAGLY    771 - 840
PKVAKIRLNLGKKRKMVKVYTKTDGLVAVHPKSVNVEQTDFHYNWLIYHLKMRTSSIYLYDCTEVSPYCL    841 - 910
LFFGGDISIQKDNDQETIAVDEWIVFQSPARIAHLVKELRKELDILLQEKIESPHPVDWNDTKSRDCAVL    911 - 980
SAIIDLIKTQEKATPRNFPPRFQDGYYS                                              981 - 1008
//

Text Mined References (39)

PMID Year Title