Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.38
PubTator Score 6.23

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 5.10318586149324E-17
malignant mesothelioma 3163 1.26985709612897E-8
Disease Target Count Z-score Confidence
acute lymphocytic leukemia 25 3.607 1.8


  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma -3.000 0.000
lung carcinoma -1.500 0.000


Accession Q9H2T7 Q8IU74


PANTHER Protein Class (1)

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
C. elegans OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

Gene RIF (4)

20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20503194 These biochemical and functional data reveal RANBP16 and RANBP17 as novel regulators of E2A protein action, and demonstrate specific interaction of E12 with RANBP17.
19913121 Observational study of gene-disease association. (HuGE Navigator)
18854154 Knockdown of RAN binding protein 17 (RANBP17) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1

AA Sequence

SVKNRDRFTQNLSVFRRDVAEALRSDGNTEPCSLDMMS                                   1051 - 1088

Text Mined References (9)

PMID Year Title
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20503194 2010 Identification of RANBP16 and RANBP17 as novel interaction partners for the bHLH transcription factor E12.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11071879 2000 Identification of a novel putative Ran-binding protein and its close homologue.
11024021 2000 Identification of two novel RanGTP-binding proteins belonging to the importin beta superfamily.