Property Summary

NCBI Gene PubMed Count 14
PubMed Score 3.16
PubTator Score 3.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.054 0.000
aldosterone-producing adenoma -1.003 0.022

Synonym

Accession Q9H2S9 Q96JP3
Symbols EOS
ZNFN1A4

Gene

PDB

2MA7  

Gene RIF (2)

PMID Text
23721563 IKZF4 polymorphism (rs1701704) was strongly associated with insulin autobody positivity at the time of type 1 diabetes diagnosis
20596022 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MHTPPALPRRFQGGGRVRTPGSHRQGKDNLERDPSGGCVPDFLPQAQDSNHFIMESLFCESSGDSSLEKE      1 - 70
FLGAPVGPSVSTPNSQHSSPSRSLSANSIKVEMYSDEESSRLLGPDERLLEKDDSVIVEDSLSEPLGYCD     71 - 140
GSGPEPHSPGGIRLPNGKLKCDVCGMVCIGPNVLMVHKRSHTGERPFHCNQCGASFTQKGNLLRHIKLHS    141 - 210
GEKPFKCPFCNYACRRRDALTGHLRTHSVSSPTVGKPYKCNYCGRSYKQQSTLEEHKERCHNYLQSLSTE    211 - 280
AQALAGQPGDEIRDLEMVPDSMLHSSSERPTFIDRLANSLTKRKRSTPQKFVGEKQMRFSLSDLPYDVNS    281 - 350
GGYEKDVELVAHHSLEPGFGSSLAFVGAEHLRPLRLPPTNCISELTPVISSVYTQMQPLPGRLELPGSRE    351 - 420
AGEGPEDLADGGPLLYRPRGPLTDPGASPSNGCQDSTDTESNHEDRVAGVVSLPQGPPPQPPPTIVVGRH    421 - 490
SPAYAKEDPKPQEGLLRGTPGPSKEVLRVVGESGEPVKAFKCEHCRILFLDHVMFTIHMGCHGFRDPFEC    491 - 560
NICGYHSQDRYEFSSHIVRGEHKVG                                                 561 - 585
//

Text Mined References (16)

PMID Year Title
23721563 2013 Associations of polymorphisms in non-HLA loci with autoantibodies at the diagnosis of type 1 diabetes: INS and IKZF4 associate with insulin autoantibodies.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22951725 2013 Association analyses identify three susceptibility Loci for vitiligo in the Chinese Han population.
22561518 2012 Genome-wide association analyses identify 13 new susceptibility loci for generalized vitiligo.
21829393 2011 Genome-wide association analysis of autoantibody positivity in type 1 diabetes cases.
21804548 2011 Genome-wide association study identifies three new susceptibility loci for adult asthma in the Japanese population.
20596022 2010 Genome-wide association study in alopecia areata implicates both innate and adaptive immunity.
18198356 2008 A novel susceptibility locus for type 1 diabetes on Chr12q13 identified by a genome-wide association study.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...