Property Summary

NCBI Gene PubMed Count 22
Grant Count 5
R01 Count 3
Funding $681,827.89
PubMed Score 67.14
PubTator Score 33.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
psoriasis -1.300 0.000
posterior fossa group A ependymoma 1.900 0.000
atypical teratoid / rhabdoid tumor 1.400 0.037
Atopic dermatitis -2.200 0.000
active ulcerative colitis -1.220 0.016
Obesity 1.100 0.033
Breast cancer -2.200 0.035
breast carcinoma -1.400 0.000
ductal carcinoma in situ -3.800 0.001
invasive ductal carcinoma -4.300 0.001

Gene RIF (12)

PMID Text
26880110 TNMD is upregulated in adipose tissue of insulin-resistant versus insulin-sensitive individuals. TNMD expression increases in human preadipocytes during differentiation, whereas silencing TNMD blocks adipogenesis.
23593173 results suggest that Tnmd acts on the maturation or maintenance of the PDL by positively regulating cell adhesion via its BRICHOS domain
22700804 Report differential expression and cellular localization of novel isoforms of the tendon biomarker tenomodulin and suggest possible roles in tenocyte proliferation and tendon injury.
19602561 Human adipose tissue TNMD gene expression is highly affected by obesity, adipose tissue location, and weight loss, indicating that TNMD may play a role in adipose tissue function.
19524323 According to these results the sequence variation of TNMD is not associated with alzheimer disease, but might modify the effect of APOE epsilon4-allele in women.
19524323 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19381347 TNMD could be a novel candidate gene for age-related macular degeneration.
19381347 Observational study of gene-disease association. (HuGE Navigator)
18982016 Observational study of gene-disease association. (HuGE Navigator)
18838562 Tenomodulin is expressed abundantly in the elastin-rich subendothelial outer layer of the normal chordae tendineae cordis.
More...

AA Sequence

MAKNPPENCEDCHILNAEAFKSKKICKSLKICGLVFGILALTLIVLFWGSKHFWPEVPKKAYDMEHTFYS      1 - 70
NGEKKKIYMEIDPVTRTEIFRSGNGTDETLEVHDFKNGYTGIYFVGLQKCFIKTQIKVIPEFSEPEEEID     71 - 140
ENEEITTTFFEQSVIWVPAEKPIENRDFLKNSKILEICDNVTMYWINPTLISVSELQDFEEEGEDLHFPA    141 - 210
NEKKGIEQNEQWVVPQVKVEKTRHARQASEEELPINDYTENGIEFDPMLDERGYCCIYCRRGNRYCRRVC    211 - 280
EPLLGYYPYPYCYQGGRVICRVIMPCNWWVARMLGRV                                     281 - 317
//

Text Mined References (23)

PMID Year Title
26880110 2016 Tenomodulin promotes human adipocyte differentiation and beneficial visceral adipose tissue expansion.
25416956 2014 A proteome-scale map of the human interactome network.
23593173 2013 Tenomodulin expression in the periodontal ligament enhances cellular adhesion.
22700804 2012 Differential expression and cellular localization of novel isoforms of the tendon biomarker tenomodulin.
19780194 2010 Tendon-selective genes identified from rat and human musculoskeletal tissues.
19602561 2009 Tenomodulin is highly expressed in adipose tissue, increased in obesity, and down-regulated during diet-induced weight loss.
19524323 2011 Tenomodulin variants, APOE and Alzheimer's disease in a Finnish case-control cohort.
19381347 2009 Single nucleotide polymorphisms of the tenomodulin gene (TNMD) in age-related macular degeneration.
18982016 2008 The genetic variation in the tenomodulin gene is associated with serum total and LDL cholesterol in a body size-dependent manner.
18838562 2008 Local tenomodulin absence, angiogenesis, and matrix metalloproteinase activation are associated with the rupture of the chordae tendineae cordis.
More...