Property Summary

NCBI Gene PubMed Count 22
PubMed Score 81.79
PubTator Score 33.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
active ulcerative colitis -1.220 1.6e-02
Atopic dermatitis -2.200 4.7e-05
atypical teratoid / rhabdoid tumor 1.400 3.7e-02
Breast cancer -2.200 3.5e-02
breast carcinoma -1.400 4.5e-11
ductal carcinoma in situ -3.800 6.2e-04
ependymoma 1.500 2.5e-03
invasive ductal carcinoma -4.300 1.4e-03
Obesity 1.100 3.3e-02
psoriasis -1.100 1.6e-03

Gene RIF (12)

AA Sequence

MAKNPPENCEDCHILNAEAFKSKKICKSLKICGLVFGILALTLIVLFWGSKHFWPEVPKKAYDMEHTFYS      1 - 70
NGEKKKIYMEIDPVTRTEIFRSGNGTDETLEVHDFKNGYTGIYFVGLQKCFIKTQIKVIPEFSEPEEEID     71 - 140
ENEEITTTFFEQSVIWVPAEKPIENRDFLKNSKILEICDNVTMYWINPTLISVSELQDFEEEGEDLHFPA    141 - 210
NEKKGIEQNEQWVVPQVKVEKTRHARQASEEELPINDYTENGIEFDPMLDERGYCCIYCRRGNRYCRRVC    211 - 280
EPLLGYYPYPYCYQGGRVICRVIMPCNWWVARMLGRV                                     281 - 317
//

Text Mined References (23)

PMID Year Title