Property Summary

NCBI Gene PubMed Count 16
PubMed Score 6.02
PubTator Score 9.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
Breast cancer 3099 7.03493936048683E-14
osteosarcoma 7933 1.14210226499538E-12
medulloblastoma, large-cell 6234 1.53120823243986E-5
adult high grade glioma 2148 0.00207632245417522
active ulcerative colitis 477 0.0212745479506896
spina bifida 1064 0.035817889435841
Disease Target Count Z-score Confidence
Behcet's disease 74 3.108 1.6

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -3.317 0.000
medulloblastoma, large-cell 1.300 0.000
active ulcerative colitis 1.319 0.021
adult high grade glioma 1.200 0.002
spina bifida -2.368 0.036
Breast cancer -1.500 0.000

Synonym

Gene

  Ortholog (5)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Pig OMA Inparanoid

Gene RIF (5)

PMID Text
20875797 these findings suggest that RNF39 and TRIM39 are involved in the etiology of Behcet's disease.
20593013 Observational study of gene-disease association. (HuGE Navigator)
19851445 Observational study of gene-disease association. (HuGE Navigator)
19693088 Observational study of gene-disease association. (HuGE Navigator)
19050382 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MWWRDLTRLRLWLKREAIPGEGRKAAKVNAGVGEKGIYTASSRGGPPSARSKAVTVVAEGAASRSWLSMD      1 - 70
APELGPGLVERLEQLATCPLCGGSFEDPVLLACEHSFCRACLARRWGTPPATGTEASPTACPCCGLPCPR     71 - 140
RSLRSNVRLAVEVRISRELREKLAEPGARAGRRRGGRIPTMGCLDLPGEDMRKTWRRFEVPTSKSSNSED    141 - 210
DLPEDYPVVKKMLHRLTADLTLDPGTAHRRLLISADRRSVQLAPPGTPAPPDGPKRFDQLPAVLGAQGFG    211 - 280
AGRHCWEVETADAASCRDSSGEDADDEESHYAVGAAGESVQRKGCVRLCPAGAVWAVEGRGGRLWALTAP    281 - 350
EPTLLGGVEPPPRRIRVDLDWERGRVAFYDGRSLDLLYAFQAPGPLGERIFPLFCTCDPRAPLRIVPAES    351 - 420
//

Text Mined References (16)

PMID Year Title
24489884 2014 Genome-wide association study of proneness to anger.
20875797 2010 TRIM39 and RNF39 are associated with Behçet's disease independently of HLA-B?51 and -A?26.
20593013 2010 A major histocompatibility Class I locus contributes to multiple sclerosis susceptibility independently from HLA-DRB1*15:01.
20041166 2009 Common genetic variation and the control of HIV-1 in humans.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19693088 2009 The HLA-B/-C haplotype block contains major determinants for host control of HIV.
19115949 2009 Genomewide association study of an AIDS-nonprogression cohort emphasizes the role played by HLA genes (ANRS Genomewide Association Study 02).
19050382 2009 Association of HLA-C and HCP5 gene regions with the clinical course of HIV-1 infection.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...