Property Summary

NCBI Gene PubMed Count 17
PubMed Score 7.07
PubTator Score 9.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count P-value
Breast cancer 3578 7.0e-14
osteosarcoma 7950 1.1e-12
medulloblastoma, large-cell 6241 1.5e-05
adult high grade glioma 3801 2.1e-03
active ulcerative colitis 764 2.1e-02
spina bifida 1074 3.6e-02
Disease Target Count Z-score Confidence
Behcet's disease 89 3.067 1.5

Expression

  Differential Expression (6)

Disease log2 FC p
active ulcerative colitis 1.319 2.1e-02
adult high grade glioma 1.200 2.1e-03
Breast cancer -1.500 7.0e-14
medulloblastoma, large-cell 1.300 1.5e-05
osteosarcoma -3.317 1.1e-12
spina bifida -2.368 3.6e-02

Gene RIF (6)

AA Sequence

MWWRDLTRLRLWLKREAIPGEGRKAAKVNAGVGEKGIYTASSRGGPPSARSKAVTVVAEGAASRSWLSMD      1 - 70
APELGPGLVERLEQLATCPLCGGSFEDPVLLACEHSFCRACLARRWGTPPATGTEASPTACPCCGLPCPR     71 - 140
RSLRSNVRLAVEVRISRELREKLAEPGARAGRRRGGRIPTMGCLDLPGEDMRKTWRRFEVPTSKSSNSED    141 - 210
DLPEDYPVVKKMLHRLTADLTLDPGTAHRRLLISADRRSVQLAPPGTPAPPDGPKRFDQLPAVLGAQGFG    211 - 280
AGRHCWEVETADAASCRDSSGEDADDEESHYAVGAAGESVQRKGCVRLCPAGAVWAVEGRGGRLWALTAP    281 - 350
EPTLLGGVEPPPRRIRVDLDWERGRVAFYDGRSLDLLYAFQAPGPLGERIFPLFCTCDPRAPLRIVPAES    351 - 420
//

Text Mined References (17)

PMID Year Title