Property Summary

NCBI Gene PubMed Count 25
Grant Count 15
R01 Count 15
Funding $1,897,176.5
PubMed Score 18.80
PubTator Score 62.40

Knowledge Summary

Patent (8,976)

Expression

  Differential Expression (15)

Gene RIF (13)

PMID Text
24434522 Differentiated dopaminergic neurons expressed low levels of SK2 channels and high levels of SK1 and SK3 channels.
23677057 KCNN2 gene can have an important role in the development of coronary artery aneurysms in Kawasaki disease.
23525437 Increase in both Ca(2+) sensitivity and SK2 protein expression contributes to the IKAS upregulation in failing human ventricles.
22154908 Decreased expression of small-conductance Ca2+-activated K+ channels SK1 and SK2 in human chronic atrial fibrillation
19815520 demonstrate that proper membrane localization of a small-conductance Ca(2+)-activated K(+) channel (SK2 or K(Ca)2.2) is dependent on its interacting protein, alpha-actinin2, a major F-actin crosslinking protein.
19139040 Present study directly defines the functional roles of SK2 channels in transgenic mice using a genetically engineered model, and provides a possible link between abnormalities in cardiac SK2 channels and cardiac arrhythmias.
17452806 Results suggest that SK2-channel activation may largely contribute to the sustained Ca2+ influx in the G0/G1 phase in comparison of that in the G2/M phase in Jurkat T-lymphocytes.
17110593 Functions of SK2 channels in atrial myocytes are critically dependent on the normal expression of Ca(v)1.3 Ca(2+) channels.
16396931 The subtype SK2 channels were up-regulated under hypoxia, shown with pharmacological tools and with mRNA analysis.
15362045 SK2 plays an important role in mediating the increase in transepithelial secretion due to increases in intracellular Ca 2+. SK2 channels, therefore, may represent a target for pharmacologic modulation of bile flow.
More...

AA Sequence

MSSCRYNGGVMRPLSNLSASRRNLHEMDSEAQPLQPPASVGGGGGASSPSAAAAAAAAVSSSAPEIVVSK      1 - 70
PEHNNSNNLALYGTGGGGSTGGGGGGGGSGHGSSSGTKSSKKKNQNIGYKLGHRRALFEKRKRLSDYALI     71 - 140
FGMFGIVVMVIETELSWGAYDKASLYSLALKCLISLSTIILLGLIIVYHAREIQLFMVDNGADDWRIAMT    141 - 210
YERIFFICLEILVCAIHPIPGNYTFTWTARLAFSYAPSTTTADVDIILSIPMFLRLYLIARVMLLHSKLF    211 - 280
TDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMW    281 - 350
LISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVK    351 - 420
NAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMY    421 - 490
DMISDLNERSEDFEKRIVTLETKLETLIGSIHALPGLISQTIRQQQRDFIEAQMESYDKHVTYNAERSRS    491 - 560
SSRRRRSSSTAPPTSSESS                                                       561 - 579
//

Text Mined References (27)

PMID Year Title
24951510 2014 Functional interaction with filamin A and intracellular Ca2+ enhance the surface membrane expression of a small-conductance Ca2+-activated K+ (SK2) channel.
24434522 2014 Subcellular expression and neuroprotective effects of SK channels in human dopaminergic neurons.
23677057 2013 Identification of KCNN2 as a susceptibility locus for coronary artery aneurysms in Kawasaki disease using genome-wide association analysis.
23525437 2013 Heterogeneous upregulation of apamin-sensitive potassium currents in failing human ventricles.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22154908 2012 Decreased expression of small-conductance Ca2+-activated K+ channels SK1 and SK2 in human chronic atrial fibrillation.
19815520 2009 Alpha-actinin2 cytoskeletal protein is required for the functional membrane localization of a Ca2+-activated K+ channel (SK2 channel).
19139040 2009 Ablation of a Ca2+-activated K+ channel (SK2 channel) results in action potential prolongation in atrial myocytes and atrial fibrillation.
17452806 2007 Cell-cycle-dependent regulation of Ca2+-activated K+ channel in Jurkat T-lymphocyte.
17110593 2007 Molecular coupling of a Ca2+-activated K+ channel to L-type Ca2+ channels via alpha-actinin2.
More...