Property Summary

NCBI Gene PubMed Count 37
PubMed Score 157.32
PubTator Score 33.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Prostate cancer 175 0.0 2.6
Disease Target Count Z-score Confidence
Respiratory Failure 104 3.301 1.7

Expression

  Differential Expression (7)

Disease log2 FC p
active Crohn's disease -1.053 4.5e-02
adult high grade glioma -1.200 6.8e-03
glioblastoma -1.300 2.8e-04
intraductal papillary-mucinous carcinoma... -1.200 2.1e-02
juvenile dermatomyositis -1.097 4.2e-10
ovarian cancer -1.100 4.8e-05
spina bifida 1.042 3.7e-02

Gene RIF (19)

AA Sequence

MWLLLTLSFLLASTAAQDGDKLLEGDECAPHSQPWQVALYERGRFNCGASLISPHWVLSAAHCQSRFMRV      1 - 70
RLGEHNLRKRDGPEQLRTTSRVIPHPRYEARSHRNDIMLLRLVQPARLNPQVRPAVLPTRCPHPGEACVV     71 - 140
SGWGLVSHNEPGTAGSPRSQVSLPDTLHCANISIISDTSCDKSYPGRLTNTMVCAGAEGRGAESCEGDSG    141 - 210
GPLVCGGILQGIVSWGDVPCDNTTKPGVYTKVCHYLEWIRETMKRN                            211 - 256
//

Text Mined References (38)

PMID Year Title