Property Summary

NCBI Gene PubMed Count 35
Grant Count 4
Funding $322,484.2
PubMed Score 148.35
PubTator Score 33.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
glioblastoma -1.300 0.000
juvenile dermatomyositis -1.097 0.000
intraductal papillary-mucinous carcinoma... -1.200 0.021
active Crohn's disease -1.053 0.045
adult high grade glioma -1.200 0.007
spina bifida 1.042 0.037
ovarian cancer -1.100 0.000

Gene RIF (17)

PMID Text
23620432 KLK15 mRNA expression levels are a novel marker for the differential diagnosis of prostate cancer.
23391636 Advanced pathologic stage was associated with significantly higher expression of KLK15 and PCA3 mRNAs.
22132073 These findings suggest a role for KLK15 genetic variation in the etiology of prostate cancer among men of European ancestry.
21457553 association with ovarian cancer survival
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20473923 Multivariate analysis identified dichotomised KLK15 expression, corrected for patient parameters age, preoperative prostate-specific antigen level, pathological tumour stage, Gleason score and surgical margins, as an prognostic factor for poor outcome.
20460480 Observational study of gene-disease association. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20424135 Observational study of gene-disease association. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MWLLLTLSFLLASTAAQDGDKLLEGDECAPHSQPWQVALYERGRFNCGASLISPHWVLSAAHCQSRFMRV      1 - 70
RLGEHNLRKRDGPEQLRTTSRVIPHPRYEARSHRNDIMLLRLVQPARLNPQVRPAVLPTRCPHPGEACVV     71 - 140
SGWGLVSHNEPGTAGSPRSQVSLPDTLHCANISIISDTSCDKSYPGRLTNTMVCAGAEGRGAESCEGDSG    141 - 210
GPLVCGGILQGIVSWGDVPCDNTTKPGVYTKVCHYLEWIRETMKRN                            211 - 256
//

Text Mined References (36)

PMID Year Title
25434496 2015 Genetic variants at 1q32.1, 10q11.2 and 19q13.41 are associated with prostate-specific antigen for prostate cancer screening in two Korean population-based cohort studies.
25416956 2014 A proteome-scale map of the human interactome network.
23936387 2013 A possible mechanism behind autoimmune disorders discovered by genome-wide linkage and association analysis in celiac disease.
23620432 2013 Quantified KLK15 gene expression levels discriminate prostate cancer from benign tumors and constitute a novel independent predictor of disease progression.
23391636 2013 Association of transcript levels of 10 established or candidate-biomarker gene targets with cancerous versus non-cancerous prostate tissue from radical prostatectomy specimens.
22505514 2012 Kallikrein-related peptidases in prostate, breast, and ovarian cancers: from pathobiology to clinical relevance.
22132073 2011 Association between Prostinogen (KLK15) genetic variants and prostate cancer risk and aggressiveness in Australia and a meta-analysis of GWAS data.
21457553 2011 A Kallikrein 15 (KLK15) single nucleotide polymorphism located close to a novel exon shows evidence of association with poor ovarian cancer survival.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20473923 2010 KLK15 is a prognostic marker for progression-free survival in patients with radical prostatectomy.
More...