Property Summary

NCBI Gene PubMed Count 23
Grant Count 19
R01 Count 4
Funding $29,938,357.67
PubMed Score 97.92
PubTator Score 31.87

Knowledge Summary

Patent

No data available

Expression

Gene RIF (11)

PMID Text
25955282 This review covers the myriad of important ADNP-protein interactions and glimpse at their potential meaning in autism, schizophrenia and Alzheimer's disease. [review]
25646590 ADNP expression was increased in male hippocampus samples compared to female samples.
25169753 Mutations in the ADNP gene cause syndromic autism.Ample evidence exists that ADNP is of key importance for proper functioning of the nBAF complex.
24531329 Ten patients with autism spectrum disorders and other shared clinical characteristics, including intellectual disability and facial dysmorphisms caused by a mutation in ADNP, a transcription factor involved in the SWI/SNF remodeling complex.
24365867 This study showed ADNP that deregulated in postmortem hippocampal samples from schizophrenia patients, but that now showed a significantly increased expression in lymphocytes from related patients.
22554909 Our results suggested that ADNP may play an important role in slowing the progression of clinical symptoms of AD.
21647709 Chromatin immunoprecipitation demonstrates the ability of ADNP to bind to its own promoter, consistent with its action as a repressor of both promoter-supported and endogenous ADNP expression.
20598862 In the prefrontal cortex of schizophrenia patients the correlation between ADNP and ADNP2 mRNA levels was apparently higher than in the hippocampus (r=0.854, p<0.001), but did not reach a significant difference (p=0.25).
19923857 ADNP is expressed in many immune system cells. ADNP mRNA is reduced in PBMCs in MS. The peptide NAP, which plays an important role in neuroprotection, has potential immunomodulatory properties.
17878164 Activity-dependent neuroprotective protein constitutes a novel element in the SWI/SNF chromatin remodeling complex.
More...

AA Sequence

MFQLPVNNLGSLRKARKTVKKILSDIGLEYCKEHIEDFKQFEPNDFYLKNTTWEDVGLWDPSLTKNQDYR      1 - 70
TKPFCCSACPFSSKFFSAYKSHFRNVHSEDFENRILLNCPYCTFNADKKTLETHIKIFHAPNASAPSSSL     71 - 140
STFKDKNKNDGLKPKQADSVEQAVYYCKKCTYRDPLYEIVRKHIYREHFQHVAAPYIAKAGEKSLNGAVP    141 - 210
LGSNAREESSIHCKRCLFMPKSYEALVQHVIEDHERIGYQVTAMIGHTNVVVPRSKPLMLIAPKPQDKKS    211 - 280
MGLPPRIGSLASGNVRSLPSQQMVNRLSIPKPNLNSTGVNMMSSVHLQQNNYGVKSVGQGYSVGQSMRLG    281 - 350
LGGNAPVSIPQQSQSVKQLLPSGNGRSYGLGSEQRSQAPARYSLQSANASSLSSGQLKSPSLSQSQASRV    351 - 420
LGQSSSKPAAAATGPPPGNTSSTQKWKICTICNELFPENVYSVHFEKEHKAEKVPAVANYIMKIHNFTSK    421 - 490
CLYCNRYLPTDTLLNHMLIHGLSCPYCRSTFNDVEKMAAHMRMVHIDEEMGPKTDSTLSFDLTLQQGSHT    491 - 560
NIHLLVTTYNLRDAPAESVAYHAQNNPPVPPKPQPKVQEKADIPVKSSPQAAVPYKKDVGKTLCPLCFSI    561 - 630
LKGPISDALAHHLRERHQVIQTVHPVEKKLTYKCIHCLGVYTSNMTASTITLHLVHCRGVGKTQNGQDKT    631 - 700
NAPSRLNQSPSLAPVKRTYEQMEFPLLKKRKLDDDSDSPSFFEEKPEEPVVLALDPKGHEDDSYEARKSF    701 - 770
LTKYFNKQPYPTRREIEKLAASLWLWKSDIASHFSNKRKKCVRDCEKYKPGVLLGFNMKELNKVKHEMDF    771 - 840
DAEWLFENHDEKDSRVNASKTADKKLNLGKEDDSSSDSFENLEEESNESGSPFDPVFEVEPKISNDNPEE    841 - 910
HVLKVIPEDASESEEKLDQKEDGSKYETIHLTEEPTKLMHNASDSEVDQDDVVEWKDGASPSESGPGSQQ    911 - 980
VSDFEDNTCEMKPGTWSDESSQSEDARSSKPAAKKKATMQGDREQLKWKNSSYGKVEGFWSKDQSQWKNA    981 - 1050
SENDERLSNPQIEWQNSTIDSEDGEQFDNMTDGVAEPMHGSLAGVKLSSQQA                     1051 - 1102
//

Text Mined References (37)

PMID Year Title
25955282 2016 The cytoskeleton as a drug target for neuroprotection: the case of the autism- mutated ADNP.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25646590 2015 Activity-dependent neuroprotective protein (ADNP) exhibits striking sexual dichotomy impacting on autistic and Alzheimer's pathologies.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25217961 2014 A meta-analysis of 87,040 individuals identifies 23 new susceptibility loci for prostate cancer.
25169753 2014 The transcriptional regulator ADNP links the BAF (SWI/SNF) complexes with autism.
24531329 2014 A SWI/SNF-related autism syndrome caused by de novo mutations in ADNP.
24365867 2015 Autophagy has a key role in the pathophysiology of schizophrenia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...