Property Summary

Ligand Count 1
NCBI Gene PubMed Count 29
PubMed Score 9.54
PubTator Score 8.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adrenocortical carcinoma -1.282 2.5e-02
Atopic dermatitis -1.100 9.2e-04
atypical teratoid/rhabdoid tumor -1.100 1.9e-05
breast carcinoma -1.100 8.5e-03
colon cancer -1.400 2.7e-03
ductal carcinoma in situ -2.600 1.4e-04
fibroadenoma -1.500 3.2e-02
invasive ductal carcinoma -3.400 3.0e-04
lung cancer 2.100 6.9e-04
malignant mesothelioma 4.800 3.3e-09
nephrosclerosis -1.811 1.0e-02
osteosarcoma 1.780 3.8e-02
pancreatic ductal adenocarcinoma liver m... -2.700 3.1e-03
subependymal giant cell astrocytoma 3.081 1.2e-02

Protein-protein Interaction (2)

Gene RIF (20)

AA Sequence

MAPAGRPGAKKGILERLESGEVVIGDGSFLITLEKRGYVKAGLWTPEAVIEHPDAVRQLHMEFLRAGSNV      1 - 70
MQTFTFSASEDNMESKWEDVNAAACDLAREVAGKGDALVAGGICQTSIYKYQKDEARIKKLFRQQLEVFA     71 - 140
WKNVDFLIAEYFEHVEEAVWAVEVLKESDRPVAVTMCIGPEGDMHDITPGECAVRLVKAGASIVGVNCRF    141 - 210
GPDTSLKTMELMKEGLEWAGLKAHLMVQPLGFHAPDCGKEGFVDLPEYPFGLESRVATRWDIQKYAREAY    211 - 280
NLGVRYIGGCCGFEPYHIRAIAEELAPERGFLPPASEKHGSWGSGLDMHTKPWIRARARREYWENLLPAS    281 - 350
GRPFCPSLSKPDF                                                             351 - 363
//

Text Mined References (31)

PMID Year Title