Property Summary

NCBI Gene PubMed Count 21
PubMed Score 1.60
PubTator Score 6.02

Knowledge Summary

Patent

No data available

Expression

Gene RIF (8)

AA Sequence

MKEDCLPSSHVPISDSKSIQKSELLGLLKTYNCYHEGKSFQLRHREEEGTLIIEGLLNIAWGLRRPIRLQ      1 - 70
MQDDREQVHLPSTSWMPRRPSCPLKEPSPQNGNITAQGPSIQPVHKAESSTDSSGPLEEAEEAPQLMRTK     71 - 140
SDASCMSQRRPKCRAPGEAQRIRRHRFSINGHFYNHKTSVFTPAYGSVTNVRVNSTMTTLQVLTLLLNKF    141 - 210
RVEDGPSEFALYIVHESGERTKLKDCEYPLISRILHGPCEKIARIFLMEADLGVEVPHEVAQYIKFEMPV    211 - 280
LDSFVEKLKEEEEREIIKLTMKFQALRLTMLQRLEQLVEAK                                 281 - 321
//

Text Mined References (22)

PMID Year Title