Property Summary

NCBI Gene PubMed Count 18
PubMed Score 1.60
PubTator Score 6.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
glioblastoma multiforme 347 1.00722948631167E-14
juvenile dermatomyositis 1189 8.1472776087919E-10
tuberculosis 1563 1.76149536914399E-7
atypical teratoid / rhabdoid tumor 4369 7.46100120438535E-7
acute quadriplegic myopathy 1157 2.15455414341683E-6
ovarian cancer 8492 2.79615395575014E-6
group 3 medulloblastoma 2254 4.00070097426155E-5
medulloblastoma, large-cell 6234 7.47781012267432E-5
lung adenocarcinoma 2714 1.61737086078513E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 3.17658900746204E-4
oligodendroglioma 2849 0.00118799350724875
head and neck cancer and chronic obstructive pulmonary disease 237 0.00134128162237112
astrocytic glioma 2241 0.00135896176071611
interstitial cystitis 2299 0.00148567909680355
osteosarcoma 7933 0.00451852809125204
pituitary cancer 1972 0.00735305545570117
gastric carcinoma 832 0.00776563070408494
active Crohn's disease 918 0.00835214936831336
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0183945626887712
primitive neuroectodermal tumor 3031 0.0264871759670073
invasive ductal carcinoma 2950 0.0264936209932618
subependymal giant cell astrocytoma 2287 0.0316109341057999
mucosa-associated lymphoid tissue lymphoma 480 0.0449176039873052

Expression

Synonym

Accession Q9H2L5 Q86WH5 Q86WH6 Q86WH7 Q8N5A9 Q8TCK6
Symbols AD037

Gene

PANTHER Protein Class (2)

  Ortholog (8)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA EggNOG Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (5)

PMID Text
25701784 RASSF4 promotes EV71 replication and the production of viral progeny to accelerate the inhibition of the phosphorylation of AKT.
23954638 expression of SPRR1B is upregulated in oral CSCs/CICs and SPRR1B has a role in cell growth by suppression of RASSF4
19066393 Single nucleotide polymorphism in RASSF4 gene is associated with acute lymphoblastic leukemia.
17373700 Observational study of gene-disease association. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKEDCLPSSHVPISDSKSIQKSELLGLLKTYNCYHEGKSFQLRHREEEGTLIIEGLLNIAWGLRRPIRLQ      1 - 70
MQDDREQVHLPSTSWMPRRPSCPLKEPSPQNGNITAQGPSIQPVHKAESSTDSSGPLEEAEEAPQLMRTK     71 - 140
SDASCMSQRRPKCRAPGEAQRIRRHRFSINGHFYNHKTSVFTPAYGSVTNVRVNSTMTTLQVLTLLLNKF    141 - 210
RVEDGPSEFALYIVHESGERTKLKDCEYPLISRILHGPCEKIARIFLMEADLGVEVPHEVAQYIKFEMPV    211 - 280
LDSFVEKLKEEEEREIIKLTMKFQALRLTMLQRLEQLVEAK                                 281 - 321
//

Text Mined References (19)

PMID Year Title
25701784 2015 RASSF4 promotes EV71 replication to accelerate the inhibition of the phosphorylation of AKT.
25416956 2014 A proteome-scale map of the human interactome network.
24366813 2013 Interaction proteome of human Hippo signaling: modular control of the co-activator YAP1.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
23954638 2013 Small proline-rich protein-1B is overexpressed in human oral squamous cell cancer stem-like cells and is related to their growth through activation of MAP kinase signal.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
20920251 2010 Frequent epigenetic inactivation of RASSF2 in thyroid cancer and functional consequences.
20562859 2010 Network organization of the human autophagy system.
19066393 2009 Acquired variation outweighs inherited variation in whole genome analysis of methotrexate polyglutamate accumulation in leukemia.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...