Property Summary

NCBI Gene PubMed Count 18
PubMed Score 1.60
PubTator Score 6.02

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

PMID Text
25701784 RASSF4 promotes EV71 replication and the production of viral progeny to accelerate the inhibition of the phosphorylation of AKT.
23954638 expression of SPRR1B is upregulated in oral CSCs/CICs and SPRR1B has a role in cell growth by suppression of RASSF4
19066393 Single nucleotide polymorphism in RASSF4 gene is associated with acute lymphoblastic leukemia.
17373700 Observational study of gene-disease association. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKEDCLPSSHVPISDSKSIQKSELLGLLKTYNCYHEGKSFQLRHREEEGTLIIEGLLNIAWGLRRPIRLQ      1 - 70
MQDDREQVHLPSTSWMPRRPSCPLKEPSPQNGNITAQGPSIQPVHKAESSTDSSGPLEEAEEAPQLMRTK     71 - 140
SDASCMSQRRPKCRAPGEAQRIRRHRFSINGHFYNHKTSVFTPAYGSVTNVRVNSTMTTLQVLTLLLNKF    141 - 210
RVEDGPSEFALYIVHESGERTKLKDCEYPLISRILHGPCEKIARIFLMEADLGVEVPHEVAQYIKFEMPV    211 - 280
LDSFVEKLKEEEEREIIKLTMKFQALRLTMLQRLEQLVEAK                                 281 - 321
//

Text Mined References (19)

PMID Year Title
25701784 2015 RASSF4 promotes EV71 replication to accelerate the inhibition of the phosphorylation of AKT.
25416956 2014 A proteome-scale map of the human interactome network.
24366813 2013 Interaction proteome of human Hippo signaling: modular control of the co-activator YAP1.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
23954638 2013 Small proline-rich protein-1B is overexpressed in human oral squamous cell cancer stem-like cells and is related to their growth through activation of MAP kinase signal.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
20920251 2010 Frequent epigenetic inactivation of RASSF2 in thyroid cancer and functional consequences.
20562859 2010 Network organization of the human autophagy system.
19066393 2009 Acquired variation outweighs inherited variation in whole genome analysis of methotrexate polyglutamate accumulation in leukemia.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...