Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.64
PubTator Score 0.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 4.8e-07
hepatocellular carcinoma 547 4.0e-04
Disease Target Count Z-score Confidence
Kidney disease 430 0.0 3.0

Expression

  Differential Expression (2)

Disease log2 FC p
hepatocellular carcinoma 1.100 4.0e-04
ovarian cancer -1.400 4.8e-07

Synonym

Accession Q9H2L4 A4D1C3 Q86UM0
Symbols DC32
C7orf35

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MRMSLAQRVLLTWLFTLLFLIMLVLKLDEKAPWNWFLIFIPVWIFDTILLVLLIVKMAGRCKSGFDPRHG      1 - 70
SHNIKKKAWYLIAMLLKLAFCLALCAKLEQFTTMNLSYVFIPLWALLAGALTELGYNVFFVRD            71 - 133
//

Text Mined References (6)

PMID Year Title