Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.70
PubTator Score 0.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
hepatocellular carcinoma 1.100 0.000
ovarian cancer -1.400 0.000

Gene RIF (1)

PMID Text
20383146 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MRMSLAQRVLLTWLFTLLFLIMLVLKLDEKAPWNWFLIFIPVWIFDTILLVLLIVKMAGRCKSGFDPRHG      1 - 70
SHNIKKKAWYLIAMLLKLAFCLALCAKLEQFTTMNLSYVFIPLWALLAGALTELGYNVFFVRD            71 - 133
//

Text Mined References (6)

PMID Year Title
20383146 2010 New loci associated with kidney function and chronic kidney disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.