Property Summary

Ligand Count 200
NCBI Gene PubMed Count 43
PubMed Score 85.96
PubTator Score 407.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.100 1.7e-03
atypical teratoid / rhabdoid tumor 2.000 4.3e-04
group 4 medulloblastoma 1.600 7.5e-03
interstitial lung disease -1.100 4.2e-02
medulloblastoma, large-cell -1.400 2.5e-03
osteosarcoma 1.954 1.0e-04
ovarian cancer -1.100 2.1e-04
pancreatic cancer -1.400 2.0e-02
pancreatic carcinoma -1.400 2.0e-02

Synonym

Accession Q9H2K2 B2RBD3 Q9H8F2 Q9HAS4 TANK2
Symbols TNKL
ARTD6
TANK2
pART6
PARP5B
PARP5C
PARP-5b
PARP-5c

Gene

PDB

2Y0I   3TWU   3KR7   3KR8   3MHJ   3MHK   3P0N   3P0P   3P0Q   3TWQ   3TWR   3TWS   3TWT   3TWV   3TWW   3TWX   3U9H   3U9Y   3UA9   3W51   4AVU   4AVW   4BFP   4BJ9   4BJB   4BJC   4BS4   4BU3   4BU5   4BU6   4BU7   4BU8   4BU9   4BUA   4BUD   4BUE   4BUF   4BUI   4BUS   4BUT   4BUU   4BUV   4BUW   4BUX   4BUY   4HKI   4HKK   4HKN   4HL5   4HLF   4HLG   4HLH   4HLK   4HLM   4HMH   4HYF   4IUE   4J1Z   4J21   4J22   4J3L   4J3M   4KZL   4KZQ   4KZU   4L09   4L0B   4L0I   4L0S   4L0T   4L0V   4L10   4L2F   4L2G   4L2K   4L31   4L32   4L33   4L34   4M7B   4PML   4PNL   4PNM   4PNN   4PNQ   4PNR   4PNS   4PNT   4TJU   4TJW   4TJY   4TK0   4TK5   4TKF   4TKG   4TKI   4UFU   4UFY   4UHG   4UI3   4UI4   4UI5   4UI6   4UI7   4UI8   4UVL   4UVN   4UVO   4UVP   4UVS   4UVT   4UVU   4UVV   4UVW   4UVX   4UVY   4UVZ   4UX4   4W5I   4Z68   5ADQ   5ADR   5ADS   5ADT   5AEH   5AKU   5AKW   5AL1   5AL2   5AL3   5AL4   5AL5   5BXO   5BXU   5C5P   5C5Q   5C5R   5DCZ   5FPF   5FPG   5JRT  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 IMPC Phenotype (1)

Protein-protein Interaction (3)

Gene RIF (24)

AA Sequence

MSGRRCAGGGAACASAAAEAVEPAARELFEACRNGDVERVKRLVTPEKVNSRDTAGRKSTPLHFAAGFGR      1 - 70
KDVVEYLLQNGANVQARDDGGLIPLHNACSFGHAEVVNLLLRHGADPNARDNWNYTPLHEAAIKGKIDVC     71 - 140
IVLLQHGAEPTIRNTDGRTALDLADPSAKAVLTGEYKKDELLESARSGNEEKMMALLTPLNVNCHASDGR    141 - 210
KSTPLHLAAGYNRVKIVQLLLQHGADVHAKDKGDLVPLHNACSYGHYEVTELLVKHGACVNAMDLWQFTP    211 - 280
LHEAASKNRVEVCSLLLSYGADPTLLNCHNKSAIDLAPTPQLKERLAYEFKGHSLLQAAREADVTRIKKH    281 - 350
LSLEMVNFKHPQTHETALHCAAASPYPKRKQICELLLRKGANINEKTKEFLTPLHVASEKAHNDVVEVVV    351 - 420
KHEAKVNALDNLGQTSLHRAAYCGHLQTCRLLLSYGCDPNIISLQGFTALQMGNENVQQLLQEGISLGNS    421 - 490
EADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGL    491 - 560
VPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLD    561 - 630
LVKDGDTDIQDLLRGDAALLDAAKKGCLARVKKLSSPDNVNCRDTQGRHSTPLHLAAGYNNLEVAEYLLQ    631 - 700
HGADVNAQDKGGLIPLHNAASYGHVDVAALLIKYNACVNATDKWAFTPLHEAAQKGRTQLCALLLAHGAD    701 - 770
PTLKNQEGQTPLDLVSADDVSALLTAAMPPSALPSCYKPQVLNGVRSPGATADALSSGPSSPSSLSAASS    771 - 840
LDNLSGSFSELSSVVSSSGTEGASSLEKKEVPGVDFSITQFVRNLGLEHLMDIFEREQITLDVLVEMGHK    841 - 910
ELKEIGINAYGHRHKLIKGVERLISGQQGLNPYLTLNTSGSGTILIDLSPDDKEFQSVEEEMQSTVREHR    911 - 980
DGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAY    981 - 1050
IGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMKMAHSPP   1051 - 1120
GHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPEGMVDG                           1121 - 1166
//

Text Mined References (46)

PMID Year Title