Property Summary

NCBI Gene PubMed Count 20
PubMed Score 12.99
PubTator Score 15.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 1.4e-04
glioblastoma -1.200 1.7e-03
medulloblastoma, large-cell -1.300 3.3e-06
osteosarcoma -1.620 1.4e-04
ovarian cancer -1.400 1.5e-05

Gene RIF (10)

AA Sequence

MAALFLKRLTLQTVKSENSCIRCFGKHILQKTAPAQLSPIASAPRLSFLIHAKAFSTAEDTQNEGKKTKK      1 - 70
NKTAFSNVGRKISQRVIHLFDEKGNDLGNMHRANVIRLMDERDLRLVQRNTSTEPAEYQLMTGLQILQER     71 - 140
QRLREMEKANPKTGPTLRKELILSSNIGQHDLDTKTKQIQQWIKKKHLVQITIKKGKNVDVSENEMEEIF    141 - 210
HQILQTMPGIATFSSRPQAVQGGKALMCVLRAFSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ      211 - 278
//

Text Mined References (23)

PMID Year Title