Property Summary

NCBI Gene PubMed Count 20
Grant Count 4
R01 Count 4
Funding $405,563
PubMed Score 12.02
PubTator Score 15.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.620 0.000
atypical teratoid / rhabdoid tumor -1.100 0.000
glioblastoma -1.200 0.002
medulloblastoma, large-cell -1.300 0.000
ovarian cancer 1.600 0.000

Gene RIF (10)

PMID Text
26337695 single nucleotide polymorphisms rs4771122 of MTIF3 was the variant most significantly associated with long-term weight loss after surgery.
26253612 genetic association studies in cohorts of prediabetic patients at multiple sites: Data suggest that an SNP in MTIF3 (rs1885988) is associated with greater weight loss following lifestyle intervention in overweight/obese subjects with prediabetes.
20976088 Observational study of gene-disease association. (HuGE Navigator)
20887776 Changes in function or expression of MTIF3 indicates mitochondrial dysfunction and contributes to the risk of Parkinson's disease.
20887776 Observational study of gene-disease association. (HuGE Navigator)
20877624 Observational study of gene-disease association. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
19209188 Meta-analysis of gene-disease association. (HuGE Navigator)
17267121 Observational study of gene-disease association. (HuGE Navigator)
17267121 the c.798C>T polymorphism of the MTIF3 gene showed allelic association with Parkinson's disease

AA Sequence

MAALFLKRLTLQTVKSENSCIRCFGKHILQKTAPAQLSPIASAPRLSFLIHAKAFSTAEDTQNEGKKTKK      1 - 70
NKTAFSNVGRKISQRVIHLFDEKGNDLGNMHRANVIRLMDERDLRLVQRNTSTEPAEYQLMTGLQILQER     71 - 140
QRLREMEKANPKTGPTLRKELILSSNIGQHDLDTKTKQIQQWIKKKHLVQITIKKGKNVDVSENEMEEIF    141 - 210
HQILQTMPGIATFSSRPQAVQGGKALMCVLRAFSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ      211 - 278
//

Text Mined References (23)

PMID Year Title
26337695 2015 rs4771122 Predicts Multiple Measures of Long-Term Weight Loss After Bariatric Surgery.
26253612 2015 Genetic Predisposition to Weight Loss and Regain With Lifestyle Intervention: Analyses From the Diabetes Prevention Program and the Look AHEAD Randomized Controlled Trials.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
20976088 2010 Possible involvement of a mitochondrial translation initiation factor 3 variant causing decreased mRNA levels in Parkinson's disease.
20935630 2010 Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index.
20887776 2010 Mitochondrial translation initiation factor 3 polymorphism and Parkinson's disease.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
19239245 2009 Evidence for an active role of IF3mt in the initiation of translation in mammalian mitochondria.
More...