Property Summary

NCBI Gene PubMed Count 15
Grant Count 2
R01 Count 1
Funding $776,475
PubMed Score 52.55
PubTator Score 16.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma -7.000 0.000
astrocytic glioma -2.600 0.002
ependymoma -3.000 0.000
oligodendroglioma -2.600 0.001
glioblastoma -3.200 0.000
sonic hedgehog group medulloblastoma 2.200 0.003
cystic fibrosis 2.728 0.000
atypical teratoid / rhabdoid tumor -3.100 0.000
medulloblastoma, large-cell 1.900 0.020
primitive neuroectodermal tumor -2.700 0.004
non-small cell lung cancer 1.359 0.000
lung cancer 1.400 0.001
adult high grade glioma -3.000 0.000
pilocytic astrocytoma -3.800 0.000
subependymal giant cell astrocytoma -2.739 0.004
Pick disease -1.900 0.001
pituitary cancer -4.200 0.000
psoriasis 1.300 0.000

Synonym

Accession Q9H2J7 A8K592 B7Z2P7 E7ESJ5 Q9H9F5
Symbols V7-3
NTT73
SBAT1
hv7-3

Gene

PANTHER Protein Class (2)

 Grant Application (2)

Gene RIF (5)

PMID Text
23820837 SNP rs1545843 associated with with local gray matter volume in median cingulate gyrus
22475622 The SLC6A15 gene plays a role in adrenocorticotropic hormone (ACTH) and cortisol secretion during cognitive impairments in unipolar depression.
21521612 The data from human genetics(SLC6A15), expression studies, brain imaging, and animal models suggest a pathophysiological mechanism for MD that may be accessible to drug targeting.
19147495 The substrate profile of the NTT4/XT1-dependent activity is similar to that of the closely related B(0)AT2/SBAT1 (SLC6A15), including a submillimolar apparent affinity for proline and leucine and a low millimolar apparent affinity for glutamine.
16226721 SBAT1-mediated transport of BCAA, particularly leucine, may be an important source of amino nitrogen for neurotransmitter synthesis in glutamatergic and GABAergic neurons.

AA Sequence

MPKNSKVVKRELDDDVTESVKDLLSNEDAADDAFKTSELIVDGQEEKDTDVEEGSEVEDERPAWNSKLQY      1 - 70
ILAQVGFSVGLGNVWRFPYLCQKNGGGAYLLPYLILLMVIGIPLFFLELSVGQRIRRGSIGVWNYISPKL     71 - 140
GGIGFASCVVCYFVALYYNVIIGWSLFYFSQSFQQPLPWDQCPLVKNASHTFVEPECEQSSATTYYWYRE    141 - 210
ALNISSSISESGGLNWKMTICLLAAWVMVCLAMIKGIQSSGKIIYFSSLFPYVVLICFLIRAFLLNGSID    211 - 280
GIRHMFTPKLEIMLEPKVWREAATQVFFALGLGFGGVIAFSSYNKRDNNCHFDAVLVSFINFFTSVLATL    281 - 350
VVFAVLGFKANVINEKCITQNSETIMKFLKMGNISQDIIPHHINLSTVTAEDYHLVYDIIQKVKEEEFPA    351 - 420
LHLNSCKIEEELNKAVQGTGLAFIAFTEAMTHFPASPFWSVMFFLMLVNLGLGSMFGTIEGIVTPIVDTF    421 - 490
KVRKEILTVICCLLAFCIGLIFVQRSGNYFVTMFDDYSATLPLLIVVILENIAVCFVYGIDKFMEDLKDM    491 - 560
LGFAPSRYYYYMWKYISPLMLLSLLIASVVNMGLSPPGYNAWIEDKASEEFLSYPTWGLVVCVSLVVFAI    561 - 630
LPVPVVFIVRRFNLIDDSSGNLASVTYKRGRVLKEPVNLEGDDTSLIHGKIPSEMPSPNFGKNIYRKQSG    631 - 700
SPTLDTAPNGRYGIGYLMADIMPDMPESDL                                            701 - 730
//

Text Mined References (22)

PMID Year Title
23942779 2013 A genome-wide association study of behavioral disinhibition.
23820837 2013 SLC6A15 rs1545843 and depression: implications from brain imaging data.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22475622 2013 A variant of the neuronal amino acid transporter SLC6A15 is associated with ACTH and cortisol responses and cognitive performance in unipolar depression.
21521612 2011 The neuronal transporter gene SLC6A15 confers risk to major depression.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19147495 2009 Synaptic Vesicle Protein NTT4/XT1 (SLC6A17) Catalyzes Na+-coupled Neutral Amino Acid Transport.
More...