Property Summary

Ligand Count 1
NCBI Gene PubMed Count 18
PubMed Score 56.80
PubTator Score 16.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -2.900 4.6e-05
astrocytic glioma -2.600 1.5e-03
Astrocytoma, Pilocytic -3.800 3.3e-13
atypical teratoid / rhabdoid tumor -2.600 9.9e-04
cystic fibrosis 2.617 4.1e-06
ependymoma -1.300 1.3e-02
glioblastoma -2.700 1.1e-06
group 3 medulloblastoma 1.300 2.0e-02
lung cancer 1.400 7.2e-04
malignant mesothelioma -7.000 3.3e-10
medulloblastoma, large-cell 1.900 2.0e-02
non-small cell lung cancer 1.359 1.8e-05
oligodendroglioma -2.400 9.3e-03
Pick disease -1.900 8.5e-04
pituitary cancer -4.200 3.6e-15
primitive neuroectodermal tumor -2.500 1.1e-02
psoriasis 1.300 1.1e-50
subependymal giant cell astrocytoma -2.739 3.6e-03

 MGI Phenotype (1)

Gene RIF (8)

AA Sequence

MPKNSKVVKRELDDDVTESVKDLLSNEDAADDAFKTSELIVDGQEEKDTDVEEGSEVEDERPAWNSKLQY      1 - 70
ILAQVGFSVGLGNVWRFPYLCQKNGGGAYLLPYLILLMVIGIPLFFLELSVGQRIRRGSIGVWNYISPKL     71 - 140
GGIGFASCVVCYFVALYYNVIIGWSLFYFSQSFQQPLPWDQCPLVKNASHTFVEPECEQSSATTYYWYRE    141 - 210
ALNISSSISESGGLNWKMTICLLAAWVMVCLAMIKGIQSSGKIIYFSSLFPYVVLICFLIRAFLLNGSID    211 - 280
GIRHMFTPKLEIMLEPKVWREAATQVFFALGLGFGGVIAFSSYNKRDNNCHFDAVLVSFINFFTSVLATL    281 - 350
VVFAVLGFKANVINEKCITQNSETIMKFLKMGNISQDIIPHHINLSTVTAEDYHLVYDIIQKVKEEEFPA    351 - 420
LHLNSCKIEEELNKAVQGTGLAFIAFTEAMTHFPASPFWSVMFFLMLVNLGLGSMFGTIEGIVTPIVDTF    421 - 490
KVRKEILTVICCLLAFCIGLIFVQRSGNYFVTMFDDYSATLPLLIVVILENIAVCFVYGIDKFMEDLKDM    491 - 560
LGFAPSRYYYYMWKYISPLMLLSLLIASVVNMGLSPPGYNAWIEDKASEEFLSYPTWGLVVCVSLVVFAI    561 - 630
LPVPVVFIVRRFNLIDDSSGNLASVTYKRGRVLKEPVNLEGDDTSLIHGKIPSEMPSPNFGKNIYRKQSG    631 - 700
SPTLDTAPNGRYGIGYLMADIMPDMPESDL                                            701 - 730
//

Text Mined References (25)

PMID Year Title