Property Summary

NCBI Gene PubMed Count 9
Grant Count 18
R01 Count 13
Funding $2,421,788.92
PubMed Score 51.91
PubTator Score 10.12

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

PMID Text
26059764 The data provide new insights for the chaperone function of PDCL3 in angiogenesis and the roles of hypoxia and N-terminal methionine acetylation in PDCL3 expression and its effect on VEGFR-2.
23792958 data provide strong evidence for the role of PDCL3 in angiogenesis and establishes the molecular mechanism by which it regulates VEGFR-2 expression and function.
17429077 Data support a model in which Plp2p modulates the biogenesis of several CCT substrates relating to cell cycle and cytoskeletal function, which together contribute to the essential function of PLP2.
17429077 Data support a model in which Plp2p modulates the biogenesis of several CCT substrates relating to cell cycle and cytoskeletal function, which together contribute to the essential function of PLP2.
12424248 This publication pertains to mouse.

AA Sequence

MQDPNADTEWNDILRKKGILPPKESLKELEEEAEEEQRILQQSVVKTYEDMTLEELEDHEDEFNEEDERA      1 - 70
IEMYRRRRLAEWKATKLKNKFGEVLEISGKDYVQEVTKAGEGLWVILHLYKQGIPLCALINQHLSGLARK     71 - 140
FPDVKFIKAISTTCIPNYPDRNLPTIFVYLEGDIKAQFIGPLVFGGMNLTRDELEWKLSESGAIMTDLEE    141 - 210
NPKKPIEDVLLSSVRRSVLMKRDSDSEGD                                             211 - 239
//

Text Mined References (16)

PMID Year Title
26059764 2015 Hypoxia-induced expression of phosducin-like 3 regulates expression of VEGFR-2 and promotes angiogenesis.
23792958 2013 Identification of PDCL3 as a novel chaperone protein involved in the generation of functional VEGF receptor 2.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17429077 2007 Functional interaction between phosducin-like protein 2 and cytosolic chaperonin is essential for cytoskeletal protein function and cell cycle progression.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
More...