Property Summary

NCBI Gene PubMed Count 11
PubMed Score 55.71
PubTator Score 10.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Budd-Chiari syndrome 12 3.15 1.6

Expression

Synonym

Accession Q9H2J4 B2RA00 Q53S68
Symbols VIAF
PHLP3
VIAF1
HTPHLP
PHLP2A

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

Gene RIF (7)

AA Sequence

MQDPNADTEWNDILRKKGILPPKESLKELEEEAEEEQRILQQSVVKTYEDMTLEELEDHEDEFNEEDERA      1 - 70
IEMYRRRRLAEWKATKLKNKFGEVLEISGKDYVQEVTKAGEGLWVILHLYKQGIPLCALINQHLSGLARK     71 - 140
FPDVKFIKAISTTCIPNYPDRNLPTIFVYLEGDIKAQFIGPLVFGGMNLTRDELEWKLSESGAIMTDLEE    141 - 210
NPKKPIEDVLLSSVRRSVLMKRDSDSEGD                                             211 - 239
//

Text Mined References (18)

PMID Year Title