Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.82
PubTator Score 6.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
adrenocortical carcinoma -1.308 1.1e-03
intraductal papillary-mucinous neoplasm ... -1.200 1.0e-02
non-small cell lung cancer -1.212 3.4e-14
osteosarcoma -1.484 8.4e-04
ovarian cancer 1.100 2.6e-05
pituitary cancer -1.300 4.1e-06
tuberculosis 1.800 1.1e-06

Synonym

Accession Q9H2I8 B1AVW6
Symbols CDA017
C10orf11

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MEKYLSLSGNHSSNKRSLEGLSAFRSLEELILDNNQLGDDLVLPGLPRLHTLTLNKNRITDLENLLDHLA      1 - 70
EVTPALEYLSLLGNVACPNELVSLEKDEEDYKRYRCFVLYKLPNLKFLDAQKVTRQEREEALVRGVFMKV     71 - 140
VKPKASSEDVASSPERHYTPLPSASRELTSHQGVLGKCRYVYYGKNSEGNRFIRDDQL                141 - 198
//

Text Mined References (15)

PMID Year Title