Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.60
PubTator Score 6.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -1.484 0.001
adrenocortical carcinoma -1.308 0.001
tuberculosis 1.800 0.000
non-small cell lung cancer -1.212 0.000
intraductal papillary-mucinous neoplasm ... -1.200 0.010
ovarian cancer 1.100 0.000
pituitary cancer -1.300 0.000

Gene RIF (3)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19844253 This finding suggests that haploinsufficiency of C10orf11 contributes to the cognitive defects in 10q22 deletion patients.
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEKYLSLSGNHSSNKRSLEGLSAFRSLEELILDNNQLGDDLVLPGLPRLHTLTLNKNRITDLENLLDHLA      1 - 70
EVTPALEYLSLLGNVACPNELVSLEKDEEDYKRYRCFVLYKLPNLKFLDAQKVTRQEREEALVRGVFMKV     71 - 140
VKPKASSEDVASSPERHYTPLPSASRELTSHQGVLGKCRYVYYGKNSEGNRFIRDDQL                141 - 198
//

Text Mined References (15)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23932459 2014 Genome-wide association study of lung function phenotypes in a founder population.
23568457 2013 Genetic variants associated with disordered eating.
23395477 2013 Mutations in c10orf11, a melanocyte-differentiation gene, cause autosomal-recessive albinism.
23284291 2012 Genome-wide joint meta-analysis of SNP and SNP-by-smoking interaction identifies novel loci for pulmonary function.
22180457 2012 A genome-wide association study identifies locus at 10q22 associated with clinical outcomes of adjuvant tamoxifen therapy for breast cancer patients in Japanese.
21946350 2011 Genome-wide association and large-scale follow up identifies 16 new loci influencing lung function.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19901119 2009 Germline genetic variation in an organic anion transporter polypeptide associated with methotrexate pharmacokinetics and clinical effects.
19844253 2010 Chromosome aberrations involving 10q22: report of three overlapping interstitial deletions and a balanced translocation disrupting C10orf11.
More...