Property Summary

NCBI Gene PubMed Count 26
Grant Count 11
R01 Count 7
Funding $564,972.29
PubMed Score 44.22
PubTator Score 34.26

Knowledge Summary

Patent

No data available

Expression

Gene RIF (18)

PMID Text
27129276 In the absence of SLC1A5 there is a crucial role of SNAT1 in supplying glutamine for glutaminolysis with SNAT2 acting as a "backup" for glutamine transport.
26439863 HIV-1 Vpu degrades SLC38A1 (SNAT1) via the same pathway utilized for antgonism of BST2 (tetherin) but occurs independently of BST2 (tetherin) downregulation
26439863 HIV-1 Vpu degrades SLC38A1 (SNAT1) via the same pathway utilized for antgonism of BST2 (tetherin) but occurs independently of BST2 (tetherin) downregulation
26439863 HIV-1 Vpu degrades SLC38A1 (SNAT1) via the same pathway utilized for antgonism of BST2 (tetherin) but occurs independently of BST2 (tetherin) downregulation
26439863 HIV-1 Vpu degrades SLC38A1 (SNAT1) via the same pathway utilized for antgonism of BST2 (tetherin) but occurs independently of BST2 (tetherin) downregulation
26439863 HIV-1 Vpu degrades SLC38A1 (SNAT1) via the same pathway utilized for antgonism of BST2 (tetherin) but occurs independently of BST2 (tetherin) downregulation
24712400 The SLC38A1 protein was very low or undetectable in healthy gastric mucosa but strong staining of SLC38A1 protein was found in the cytoplasm in more than half of gastric cancer samples. SLC38A1 knockdown decreased tumor cell proliferation and migration.
23848995 The cross-talk between Akt signaling and SNAT1 might play a critical role in the development and progression of breast cancer
23408887 SLC38A1 and SLC38A2 transcript levels are altered in placental malaria with intervillositis.
21219957 results suggest that slc38a1 may play a role in the mechanisms underlying the determination of cellular viability in astrocytes through modulation of intracellular ROS generation
More...

AA Sequence

MMHFKSGLELTELQNMTVPEDDNISNDSNDFTEVENGQINSKFISDRESRRSLTNSHLEKKKCDEYIPGT      1 - 70
TSLGMSVFNLSNAIMGSGILGLAFALANTGILLFLVLLTSVTLLSIYSINLLLICSKETGCMVYEKLGEQ     71 - 140
VFGTTGKFVIFGATSLQNTGAMLSYLFIVKNELPSAIKFLMGKEETFSAWYVDGRVLVVIVTFGIILPLC    141 - 210
LLKNLGYLGYTSGFSLSCMVFFLIVVIYKKFQIPCIVPELNSTISANSTNADTCTPKYVTFNSKTVYALP    211 - 280
TIAFAFVCHPSVLPIYSELKDRSQKKMQMVSNISFFAMFVMYFLTAIFGYLTFYDNVQSDLLHKYQSKDD    281 - 350
ILILTVRLAVIVAVILTVPVLFFTVRSSLFELAKKTKFNLCRHTVVTCILLVVINLLVIFIPSMKDIFGV    351 - 420
VGVTSANMLIFILPSSLYLKITDQDGDKGTQRIWAALFLGLGVLFSLVSIPLVIYDWACSSSSDEGH       421 - 487
//

Text Mined References (36)

PMID Year Title
27129276 2016 Deletion of Amino Acid Transporter ASCT2 (SLC1A5) Reveals an Essential Role for Transporters SNAT1 (SLC38A1) and SNAT2 (SLC38A2) to Sustain Glutaminolysis in Cancer Cells.
25416956 2014 A proteome-scale map of the human interactome network.
24712400 2014 Overexpression of SLC38A1 is associated with poorer prognosis in Chinese patients with gastric cancer.
23848995 2013 Activation of SNAT1/SLC38A1 in human breast cancer: correlation with p-Akt overexpression.
23506890 Evolutionary origin of amino acid transporter families SLC32, SLC36 and SLC38 and physiological, pathological and therapeutic aspects.
23408887 2013 Plasmodium falciparum malaria elicits inflammatory responses that dysregulate placental amino acid transport.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21219957 2011 Exacerbated vulnerability to oxidative stress in astrocytic C6 glioma cells with stable overexpression of the glutamine transporter slc38a1.
20605601 2011 Overexpression of ATA1/SLC38A1 predicts future recurrence and death in Chinese patients with hilar cholangiocarcinoma.
More...