Property Summary

NCBI Gene PubMed Count 26
PubMed Score 44.22
PubTator Score 34.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 7.88633906439151E-31
non-small cell lung cancer 2798 7.93551604364702E-12
juvenile dermatomyositis 1189 3.01439820311923E-9
ovarian cancer 8492 1.46136361332755E-6
ependymoma 2514 3.73189984264544E-6
atypical teratoid/rhabdoid tumor 1095 4.06415228944619E-5
lung cancer 4473 1.00131696713644E-4
osteosarcoma 7933 4.20430893574425E-4
pediatric high grade glioma 2712 0.00193248448787616
breast carcinoma 1614 0.00230081718528384
ductal carcinoma in situ 1745 0.00412719609729761
Duchenne muscular dystrophy 602 0.00453401232119322
Multiple myeloma 1328 0.00536768911275077
invasive ductal carcinoma 2950 0.0103234454905222
gastric carcinoma 832 0.0123777599409412
subependymal giant cell astrocytoma 2287 0.0145489380949007
glioblastoma 5572 0.0204420186547612
oligodendroglioma 2849 0.0215556208601916
acute quadriplegic myopathy 1157 0.0224362653467271
primary Sjogren syndrome 789 0.0312861412263268
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0364491673606001
fibroadenoma 557 0.0393518687151662
X-linked cerebral adrenoleukodystrophy 115 0.0421805998276055
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.0484456329338954
Disease Target Count Z-score Confidence
Klatskin's tumor 3 4.266 2.1

Expression

Synonym

Accession Q9H2H9 Q8NC61 Q8NCF8 Q96JX2 Q9H2Q2
Symbols ATA1
NAT2
SAT1
SNAT1

Gene

PANTHER Protein Class (2)

  Ortholog (11)

Gene RIF (14)

PMID Text
27129276 In the absence of SLC1A5 there is a crucial role of SNAT1 in supplying glutamine for glutaminolysis with SNAT2 acting as a "backup" for glutamine transport.
26439863 HIV-1 Vpu degrades SLC38A1 (SNAT1) via the same pathway utilized for antgonism of BST2 (tetherin) but occurs independently of BST2 (tetherin) downregulation
24712400 The SLC38A1 protein was very low or undetectable in healthy gastric mucosa but strong staining of SLC38A1 protein was found in the cytoplasm in more than half of gastric cancer samples. SLC38A1 knockdown decreased tumor cell proliferation and migration.
23848995 The cross-talk between Akt signaling and SNAT1 might play a critical role in the development and progression of breast cancer
23408887 SLC38A1 and SLC38A2 transcript levels are altered in placental malaria with intervillositis.
21219957 results suggest that slc38a1 may play a role in the mechanisms underlying the determination of cellular viability in astrocytes through modulation of intracellular ROS generation
20605601 Increased expression of ATA1 is frequent in human hilar cholangiocarcinoma and significantly correlated with the progression of cholangiocarcinoma, suggesting the importance of ATA1 in cancer development and progression.
20599747 SNAT1 is a key contributor to system A activity at term.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20308991 The results of this study provided that RAB2A and SLC38A1, were associated with the density of calbindin-positive neurons and the number of perineuronal oligodendrocytes in psychiatric disorders.
More...

AA Sequence

MMHFKSGLELTELQNMTVPEDDNISNDSNDFTEVENGQINSKFISDRESRRSLTNSHLEKKKCDEYIPGT      1 - 70
TSLGMSVFNLSNAIMGSGILGLAFALANTGILLFLVLLTSVTLLSIYSINLLLICSKETGCMVYEKLGEQ     71 - 140
VFGTTGKFVIFGATSLQNTGAMLSYLFIVKNELPSAIKFLMGKEETFSAWYVDGRVLVVIVTFGIILPLC    141 - 210
LLKNLGYLGYTSGFSLSCMVFFLIVVIYKKFQIPCIVPELNSTISANSTNADTCTPKYVTFNSKTVYALP    211 - 280
TIAFAFVCHPSVLPIYSELKDRSQKKMQMVSNISFFAMFVMYFLTAIFGYLTFYDNVQSDLLHKYQSKDD    281 - 350
ILILTVRLAVIVAVILTVPVLFFTVRSSLFELAKKTKFNLCRHTVVTCILLVVINLLVIFIPSMKDIFGV    351 - 420
VGVTSANMLIFILPSSLYLKITDQDGDKGTQRIWAALFLGLGVLFSLVSIPLVIYDWACSSSSDEGH       421 - 487
//

Text Mined References (36)

PMID Year Title
27129276 2016 Deletion of Amino Acid Transporter ASCT2 (SLC1A5) Reveals an Essential Role for Transporters SNAT1 (SLC38A1) and SNAT2 (SLC38A2) to Sustain Glutaminolysis in Cancer Cells.
25416956 2014 A proteome-scale map of the human interactome network.
24712400 2014 Overexpression of SLC38A1 is associated with poorer prognosis in Chinese patients with gastric cancer.
23848995 2013 Activation of SNAT1/SLC38A1 in human breast cancer: correlation with p-Akt overexpression.
23506890 Evolutionary origin of amino acid transporter families SLC32, SLC36 and SLC38 and physiological, pathological and therapeutic aspects.
23408887 2013 Plasmodium falciparum malaria elicits inflammatory responses that dysregulate placental amino acid transport.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21219957 2011 Exacerbated vulnerability to oxidative stress in astrocytic C6 glioma cells with stable overexpression of the glutamine transporter slc38a1.
20605601 2011 Overexpression of ATA1/SLC38A1 predicts future recurrence and death in Chinese patients with hilar cholangiocarcinoma.
More...