Property Summary

NCBI Gene PubMed Count 17
PubMed Score 7.21
PubTator Score 27.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
Rheumatoid Arthritis -1.300 0.009
ovarian cancer -2.100 0.000

Synonym

Accession Q9H2H8 Q86WF9 Q96IA9 Q9BXZ1 PPIase
Symbols CYPJ

Gene

PANTHER Protein Class (1)

PDB

1XYH   2OJU   2OK3  

Gene RIF (6)

PMID Text
26977013 CYPJ structurally resembles CYPA. It is sensitive to inhibition by CsA and plays a role in regulating cell growth, proliferation, and apoptosis.
26020957 Suppression of CYPJ could repress the growth of HCC, which makes CYPJ a potential target for the development of new strategies to treat this malignancy.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18474220 Human peptidyl-prolyl isomerase-like 3 (Ppil3) is one of the Apoptin-associated proteins.
16510998 Human cyclophilin J, a new member of the cyclophilin family, has been expressed and crystallized.
15989758 The novel full-length gene of human PPIL3 may be correlated with the formation of human glioma.

AA Sequence

MSVTLHTDVGDIKIEVFCERTPKTCENFLALCASNYYNGCIFHRNIKGFMVQTGDPTGTGRGGNSIWGKK      1 - 70
FEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGKVIDGLETLDELEKLPVNEKT     71 - 140
YRPLNDVHIKDITIHANPFAQ                                                     141 - 161
//

Text Mined References (21)

PMID Year Title
26977013 2016 Biochemical Features of Recombinant Human Cyclophilin J.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26020957 2015 Cyclophilin J is a novel peptidyl-prolyl isomerase and target for repressing the growth of hepatocellular carcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
More...