Property Summary

NCBI Gene PubMed Count 10
Grant Count 1
Funding $117,852.56
PubMed Score 8.05
PubTator Score 7.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma 1.576 0.000
adult high grade glioma -1.100 0.026
group 3 medulloblastoma 2.100 0.003
posterior fossa group A ependymoma -1.400 0.000
lung carcinoma 1.700 0.000
pituitary cancer 1.200 0.000
psoriasis -1.200 0.000

Gene RIF (7)

PMID Text
25085016 Age of patients and levels of CXXC4 mRNA, hemoglobin, and marrow blast associated with survival of Myelodysplastic syndrome patients.
25064842 EZH2 can activate MAPK signaling by inhibiting CXXC4 expression.
23949225 CXXC4 is a novel potential tumor suppressor directly regulated by EZH2, and its expression is a significant prognosis factor for patients with early stages of gastric cancer.
23563267 IDAX expression results in caspase activation and TET2 protein downregulation, in a manner that depends on DNA binding through the IDAX CXXC domain, suggesting that IDAX recruits TET2 to DNA before degradation
20332099 Observational study of gene-disease association. (HuGE Navigator)
19460752 Knockdown of CXXC finger protein 4 (CXXC4; IDAX) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
18931698 Decreased CXXC4 was associated with kidney cancer metastasis, poor survival, beta-catenin translocation, cell proliferation, reduced apoptosis in response to cancer drugs, and upregulation of genes involed in proliferation, invasion, and cell survival.

AA Sequence

MHHRNDSQRLGKAGCPPEPSLQMANTNFLSTLSPEHCRPLAGECMNKLKCGAAEAEIMNLPERVGTFSAI      1 - 70
PALGGISLPPGVIVMTALHSPAAASAAVTDSAFQIANLADCPQNHSSSSSSSSGGAGGANPAKKKRKRCG     71 - 140
VCVPCKRLINCGVCSSCRNRKTGHQICKFRKCEELKKKPGTSLERTPVPSAEAFRWFF                141 - 198
//

Text Mined References (12)

PMID Year Title
25085016 2014 CXXC4 mRNA levels are associated with clinicopathological parameters and survival of myelodysplastic syndrome patients.
25064842 2014 New tumor suppressor CXXC finger protein 4 inactivates mitogen activated protein kinase signaling.
23949225 2013 Enhancer of zeste homolog 2 activates wnt signaling through downregulating CXXC finger protein 4.
23563267 2013 Modulation of TET2 expression and 5-methylcytosine oxidation by the CXXC domain protein IDAX.
20514431 2010 Differentiation of tubular and villous adenomas based on Wnt pathway-related gene expression profiles.
20332099 2010 A systematic gene-based screen of chr4q22-q32 identifies association of a novel susceptibility gene, DKK2, with the quantitative trait of alcohol dependence symptom counts.
18931698 2009 Decreased expression of CXXC4 promotes a malignant phenotype in renal cell carcinoma by activating Wnt signaling.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...