Property Summary

NCBI Gene PubMed Count 10
PubMed Score 9.73
PubTator Score 7.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Villous adenoma 1 3.305 1.7

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.100 2.6e-02
group 3 medulloblastoma 1.300 4.3e-03
lung carcinoma 1.700 6.6e-23
osteosarcoma 1.576 1.5e-04
pituitary cancer 1.200 7.6e-05
posterior fossa group A ependymoma -1.100 1.6e-07
psoriasis -1.200 3.9e-18

Gene RIF (7)

AA Sequence

MHHRNDSQRLGKAGCPPEPSLQMANTNFLSTLSPEHCRPLAGECMNKLKCGAAEAEIMNLPERVGTFSAI      1 - 70
PALGGISLPPGVIVMTALHSPAAASAAVTDSAFQIANLADCPQNHSSSSSSSSGGAGGANPAKKKRKRCG     71 - 140
VCVPCKRLINCGVCSSCRNRKTGHQICKFRKCEELKKKPGTSLERTPVPSAEAFRWFF                141 - 198
//

Text Mined References (12)

PMID Year Title