Property Summary

NCBI Gene PubMed Count 20
PubMed Score 12.26
PubTator Score 29.29

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
intraductal papillary-mucinous carcinoma... 1.200 2.9e-02
intraductal papillary-mucinous neoplasm ... 1.600 1.3e-02
osteosarcoma -1.453 1.0e-03
spina bifida -2.216 4.0e-02

Gene RIF (4)

AA Sequence

MTTKNLETKVTVTSSPIRGAGDGMETEEPPKSVEVTSGVQSRKHHSLQSPWKKAVPSESPGVLQLGKMLT      1 - 70
EKAMEVKAVRILVPKAAITHDIPNKNTKVKSLGHHKGEFLGQSEGVIEPNKELSEVKNVLEKLKNSERRL     71 - 140
LQDKEGLSNQLRVQTEVNRELKKLLVASVGDDLQYHFERLAREKNQLILENEALGRNTAQLSEQLERMSI    141 - 210
QCDVWRSKFLASRVMADELTNSRAALQRQNRDAHGAIQDLLSEREQFRQEMIATQKLLEELLVSLQWGRE    211 - 280
QTYSPSVQPHSTAELALTNHKLAKAVNSHLLGNVGINNQKKIPSTVEFCSTPAEKMAETVLRILDPVTCK    281 - 350
ESSPDNPFFESSPTTLLATKKNIGRFHPYTRYENITFNCCNHCRGELIAL                        351 - 400
//

Text Mined References (23)

PMID Year Title