Property Summary

NCBI Gene PubMed Count 18
Grant Count 4
R01 Count 4
Funding $193,138.33
PubMed Score 11.77
PubTator Score 29.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Synonym

Accession Q9H2G9 O15298 Q5T531 Q5T533 Q9GZX4
Symbols JEM1
JEM-1
JEM-1s
GOLGIN-45

Gene

Gene RIF (4)

PMID Text
26342799 prognostic value of BLZF1 was further confirmed by stratified analyses. Collectively, our data suggest BLZF1 is a novel unfavorable biomarker for prognosis of patients with HCC
19536175 Observational study of gene-disease association. (HuGE Navigator)
19064610 Observational study of gene-disease association. (HuGE Navigator)
11739401 JEM-1/Golgin-45 is a Golgi localised coiled-coil protein that directly interacts with the active form of the small GTPase rab2, suggesting a function in protein transport.

AA Sequence

MTTKNLETKVTVTSSPIRGAGDGMETEEPPKSVEVTSGVQSRKHHSLQSPWKKAVPSESPGVLQLGKMLT      1 - 70
EKAMEVKAVRILVPKAAITHDIPNKNTKVKSLGHHKGEFLGQSEGVIEPNKELSEVKNVLEKLKNSERRL     71 - 140
LQDKEGLSNQLRVQTEVNRELKKLLVASVGDDLQYHFERLAREKNQLILENEALGRNTAQLSEQLERMSI    141 - 210
QCDVWRSKFLASRVMADELTNSRAALQRQNRDAHGAIQDLLSEREQFRQEMIATQKLLEELLVSLQWGRE    211 - 280
QTYSPSVQPHSTAELALTNHKLAKAVNSHLLGNVGINNQKKIPSTVEFCSTPAEKMAETVLRILDPVTCK    281 - 350
ESSPDNPFFESSPTTLLATKKNIGRFHPYTRYENITFNCCNHCRGELIAL                        351 - 400
//

Text Mined References (21)

PMID Year Title
26342799 2015 BLZF1 expression is of prognostic significance in hepatocellular carcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21478859 2011 RNF146 is a poly(ADP-ribose)-directed E3 ligase that regulates axin degradation and Wnt signalling.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19536175 2009 Follow-up of a major linkage peak on chromosome 1 reveals suggestive QTLs associated with essential hypertension: GenNet study.
19064610 2009 Pre-B-cell leukemia homeobox 1 (PBX1) shows functional and possible genetic association with bone mineral density variation.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
More...