Property Summary

NCBI Gene PubMed Count 31
PubMed Score 33.34
PubTator Score 706.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Endometrial Neoplasms 55 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Gonadoblastoma 34 5.001 2.5

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.100 4.3e-04
atypical teratoid/rhabdoid tumor -1.200 1.1e-05
Breast cancer -1.200 4.2e-05
ependymoma -1.700 5.8e-15
glioblastoma -1.200 2.9e-08
group 3 medulloblastoma -1.800 3.3e-05
lung carcinoma 1.700 1.3e-24
medulloblastoma, large-cell -1.400 3.6e-06
non-small cell lung cancer -1.094 1.1e-18
Pick disease -1.200 3.6e-04
psoriasis -1.600 4.6e-05
subependymal giant cell astrocytoma -1.409 5.2e-03
tuberculosis -1.500 1.0e-06

 GO Function (1)

Gene RIF (16)

AA Sequence

MDRPDEGPPAKTRRLSSSESPQRDPPPPPPPPPLLRLPLPPPQQRPRLQEETEAAQVLADMRGVGLGPAL      1 - 70
PPPPPYVILEEGGIRAYFTLGAECPGWDSTIESGYGEAPPPTESLEALPTPEASGGSLEIDFQVVQSSSF     71 - 140
GGEGALETCSAVGWAPQRLVDPKSKEEAIIIVEDEDEDERESMRSSRRRRRRRRRKQRKVKRESRERNAE    141 - 210
RMESILQALEDIQLDLEAVNIKAGKAFLRLKRKFIQMRRPFLERRDLIIQHIPGFWVKAFLNHPRISILI    211 - 280
NRRDEDIFRYLTNLQVQDLRHISMGYKMKLYFQTNPYFTNMVIVKEFQRNRSGRLVSHSTPIRWHRGQEP    281 - 350
QARRHGNQDASHSFFSWFSNHSLPEADRIAEIIKNDLWVNPLRYYLRERGSRIKRKKQEMKKRKTRGRCE    351 - 420
VVIMEDAPDYYAVEDIFSEISDIDETIHDIKISDFMETTDYFETTDNEITDINENICDSENPDHNEVPNN    421 - 490
ETTDNNESADDHETTDNNESADDNNENPEDNNKNTDDNEENPNNNENTYGNNFFKGGFWGSHGNNQDSSD    491 - 560
SDNEADEASDDEDNDGNEGDNEGSDDDGNEGDNEGSDDDDRDIEYYEKVIEDFDKDQADYEDVIEIISDE    561 - 630
SVEEEGIEEGIQQDEDIYEEGNYEEEGSEDVWEEGEDSDDSDLEDVLQVPNGWANPGKRGKTG           631 - 693
//

Text Mined References (41)

PMID Year Title