Property Summary

Ligand Count 13
NCBI Gene PubMed Count 30
PubMed Score 211.39
PubTator Score 58.28

Knowledge Summary

Patent (21,845)

TINX Plot

  Disease (6)

Expression

  Differential Expression (21)

Disease log2 FC p
acute quadriplegic myopathy 1.316 1.0e-05
adult high grade glioma -1.800 2.4e-06
Amyotrophic lateral sclerosis 1.074 3.6e-07
astrocytic glioma -1.500 2.9e-02
dermatomyositis 1.700 1.8e-04
ependymoma -1.500 2.4e-02
glioblastoma -1.200 8.1e-06
Hydrolethalus syndrome 1.257 3.9e-02
intraductal papillary-mucinous neoplasm ... 1.200 2.4e-02
invasive ductal carcinoma -1.400 1.1e-04
lung adenocarcinoma -1.056 5.3e-04
lung cancer -1.200 7.2e-03
malignant mesothelioma 1.200 6.1e-05
medulloblastoma, large-cell -1.200 1.8e-05
non-small cell lung cancer -1.253 8.6e-14
oligodendroglioma -1.300 3.7e-02
ovarian cancer -2.400 7.4e-08
primitive neuroectodermal tumor -1.100 4.7e-04
progressive supranuclear palsy -1.300 1.9e-02
psoriasis 1.200 3.9e-04
spina bifida -1.765 4.5e-02

Gene RIF (9)

AA Sequence

MSFFNFRKIFKLGSEKKKKQYEHVKRDLNPEDFWEIIGELGDGAFGKVYKAQNKETSVLAAAKVIDTKSE      1 - 70
EELEDYMVEIDILASCDHPNIVKLLDAFYYENNLWILIEFCAGGAVDAVMLELERPLTESQIQVVCKQTL     71 - 140
DALNYLHDNKIIHRDLKAGNILFTLDGDIKLADFGVSAKNTRTIQRRDSFIGTPYWMAPEVVMCETSKDR    141 - 210
PYDYKADVWSLGITLIEMAEIEPPHHELNPMRVLLKIAKSEPPTLAQPSRWSSNFKDFLKKCLEKNVDAR    211 - 280
WTTSQLLQHPFVTVDSNKPIRELIAEAKAEVTEEVEDGKEEDEEEETENSLPIPASKRASSDLSIASSEE    281 - 350
DKLSQNACILESVSEKTERSNSEDKLNSKILNEKPTTDEPEKAVEDINEHITDAQLEAMTELHDRTAVIK    351 - 420
ENEREKRPKLENLPDTEDQETVDINSVSEGKENNIMITLETNIEHNLKSEEEKDQEKQQMFENKLIKSEE    421 - 490
IKDTILQTVDLVSQETGEKEANIQAVDSEVGLTKEDTQEKLGEDDKTQKDVISNTSDVIGTCEAADVAQK    491 - 560
VDEDSAEDTQSNDGKEVVEVGQKLINKPMVGPEAGGTKEVPIKEIVEMNEIEEGKNKEQAINSSENIMDI    561 - 630
NEEPGTTEGEEITESSSTEEMEVRSVVADTDQKALGSEVQDASKVTTQIDKEKKEIPVSIKKEPEVTVVS    631 - 700
QPTEPQPVLIPSININSDSGENKEEIGSLSKTETILPPESENPKENDNDSGTGSTADTSSIDLNLSISSF    701 - 770
LSKTKDSGSISLQETRRQKKTLKKTRKFIVDGVEVSVTTSKIVTDSDSKTEELRFLRRQELRELRFLQKE    771 - 840
EQRAQQQLNSKLQQQREQIFRRFEQEMMSKKRQYDQEIENLEKQQKQTIERLEQEHTNRLRDEAKRIKGE    841 - 910
QEKELSKFQNMLKNRKKEVINEVEKAPKELRKELMKRRKEELAQSQHAQEQEFVQKQQQELDGSLKKIIQ    911 - 980
QQKAELANIERECLNNKQQLMRAREAAIWELEERHLQEKHQLLKQQLKDQYFMQRHQLLKRHEKETEQMQ    981 - 1050
RYNQRLIEELKNRQTQERARLPKIQRSEAKTRMAMFKKSLRINSTATPDQDRDKIKQFAAQEEKRQKNER   1051 - 1120
MAQHQKHENQMRDLQLQCEANVRELHQLQNEKCHLLVEHETQKLKELDEEHSQELKEWREKLRPRKKTLE   1121 - 1190
EEFARKLQEQEVFFKMTGESECLNPSTQSRISKFYPIPSLHSTGS                            1191 - 1235
//

Text Mined References (40)

PMID Year Title