Property Summary

NCBI Gene PubMed Count 30
Grant Count 128
R01 Count 92
Funding $14,597,339.7
PubMed Score 236.10
PubTator Score 58.28

Knowledge Summary

Patent (21,845)

Expression

  Differential Expression (21)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
astrocytic glioma -1.500 0.029
ependymoma -1.500 0.024
oligodendroglioma -1.300 0.037
psoriasis 1.200 0.000
glioblastoma -1.500 0.011
medulloblastoma, large-cell -1.200 0.000
primitive neuroectodermal tumor -1.100 0.000
Amyotrophic Lateral Sclerosis 1.074 0.000
acute quadriplegic myopathy 1.632 0.000
non-small cell lung cancer -1.253 0.000
intraductal papillary-mucinous neoplasm ... 1.200 0.024
Hydrolethalus syndrome 1.257 0.039
lung cancer -1.400 0.000
adult high grade glioma -1.800 0.000
lung adenocarcinoma -1.056 0.001
spina bifida -1.765 0.045
progressive supranuclear palsy -1.300 0.019
invasive ductal carcinoma -1.400 0.000
ovarian cancer -2.400 0.000
dermatomyositis 1.700 0.000

Synonym

Accession Q9H2G2 D3DRA0 D3DRA1 O00211 Q6P1Z4 Q86WU7 Q86WW1 Q92603 Q9NQL0 Q9NQL1 STE20-like kinase
Symbols LOSK
STK2
se20-9
bA16H23.1

Gene

SLK

PDB

2J51   2JFL   2JFM   2UV2   4USF  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (9)

PMID Text
26094769 SLK interacts with Tpr and alpha-actinin-4 in cells, and these protein-protein interactions may control the subcellular localization and the biological activity of SLK.
24958772 SLK activated ERMs, together with Galphai, are critical for the correct localization of LGN-NuMA force generator complexes and hence for proper spindle orientation.
23985322 The fact that SLK (LOSK) phosphorylates only a minor isoform 1A of p150(Glued) suggests that transport and microtubule-organizing functions of dynactin are distinctly divided between the two isoforms
23209304 It was shown that lymphocyte-oriented and STE20 kinase were sufficient to restrict ezrin function to the apical domain. Both kinases were enriched in microvilli and locally activated there.
19525980 Studies define an interaction between Neu and SLK signaling in the regulation of cancer cell motility.
18287541 Protein kinase LOSK is required for radial microtubule organization and for the proper localization of Golgi complex in various cell types.
17321610 we show that a novel isoform of SPS1-related proline alanine-rich kinase (SPAK/STE20) is involved in this inflammatory signaling cascade
16837460 v-Src-dependent down-regulation of the Ste20-like kinase SLK through casein kinase II.
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSFFNFRKIFKLGSEKKKKQYEHVKRDLNPEDFWEIIGELGDGAFGKVYKAQNKETSVLAAAKVIDTKSE      1 - 70
EELEDYMVEIDILASCDHPNIVKLLDAFYYENNLWILIEFCAGGAVDAVMLELERPLTESQIQVVCKQTL     71 - 140
DALNYLHDNKIIHRDLKAGNILFTLDGDIKLADFGVSAKNTRTIQRRDSFIGTPYWMAPEVVMCETSKDR    141 - 210
PYDYKADVWSLGITLIEMAEIEPPHHELNPMRVLLKIAKSEPPTLAQPSRWSSNFKDFLKKCLEKNVDAR    211 - 280
WTTSQLLQHPFVTVDSNKPIRELIAEAKAEVTEEVEDGKEEDEEEETENSLPIPASKRASSDLSIASSEE    281 - 350
DKLSQNACILESVSEKTERSNSEDKLNSKILNEKPTTDEPEKAVEDINEHITDAQLEAMTELHDRTAVIK    351 - 420
ENEREKRPKLENLPDTEDQETVDINSVSEGKENNIMITLETNIEHNLKSEEEKDQEKQQMFENKLIKSEE    421 - 490
IKDTILQTVDLVSQETGEKEANIQAVDSEVGLTKEDTQEKLGEDDKTQKDVISNTSDVIGTCEAADVAQK    491 - 560
VDEDSAEDTQSNDGKEVVEVGQKLINKPMVGPEAGGTKEVPIKEIVEMNEIEEGKNKEQAINSSENIMDI    561 - 630
NEEPGTTEGEEITESSSTEEMEVRSVVADTDQKALGSEVQDASKVTTQIDKEKKEIPVSIKKEPEVTVVS    631 - 700
QPTEPQPVLIPSININSDSGENKEEIGSLSKTETILPPESENPKENDNDSGTGSTADTSSIDLNLSISSF    701 - 770
LSKTKDSGSISLQETRRQKKTLKKTRKFIVDGVEVSVTTSKIVTDSDSKTEELRFLRRQELRELRFLQKE    771 - 840
EQRAQQQLNSKLQQQREQIFRRFEQEMMSKKRQYDQEIENLEKQQKQTIERLEQEHTNRLRDEAKRIKGE    841 - 910
QEKELSKFQNMLKNRKKEVINEVEKAPKELRKELMKRRKEELAQSQHAQEQEFVQKQQQELDGSLKKIIQ    911 - 980
QQKAELANIERECLNNKQQLMRAREAAIWELEERHLQEKHQLLKQQLKDQYFMQRHQLLKRHEKETEQMQ    981 - 1050
RYNQRLIEELKNRQTQERARLPKIQRSEAKTRMAMFKKSLRINSTATPDQDRDKIKQFAAQEEKRQKNER   1051 - 1120
MAQHQKHENQMRDLQLQCEANVRELHQLQNEKCHLLVEHETQKLKELDEEHSQELKEWREKLRPRKKTLE   1121 - 1190
EEFARKLQEQEVFFKMTGESECLNPSTQSRISKFYPIPSLHSTGS                            1191 - 1235
//

Text Mined References (40)

PMID Year Title
26818812 2016 SLK/LOSK kinase regulates cell motility independently of microtubule organization and Golgi polarization.
26094769 2015 Identification of Tpr and ?-actinin-4 as two novel SLK-interacting proteins.
25882817 2015 Recruitment and activation of SLK at the leading edge of migrating cells requires Src family kinase activity and the LIM-only protein 4.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24958772 2014 SLK-dependent activation of ERMs controls LGN-NuMA localization and spindle orientation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23985322 2013 Ste20-like protein kinase SLK (LOSK) regulates microtubule organization by targeting dynactin to the centrosome.
23209304 2012 Local phosphocycling mediated by LOK/SLK restricts ezrin function to the apical aspect of epithelial cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23128389 2013 SLK-mediated phosphorylation of paxillin is required for focal adhesion turnover and cell migration.
More...