Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.74
PubTator Score 3.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adrenocortical carcinoma -1.625 3.6e-10
cystic fibrosis 2.669 8.1e-06
ependymoma -1.300 4.6e-03
group 4 medulloblastoma -1.100 9.5e-03
intraductal papillary-mucinous adenoma (... 1.800 2.3e-03
intraductal papillary-mucinous carcinoma... 1.300 2.3e-02
intraductal papillary-mucinous neoplasm ... 1.500 3.7e-02
lung adenocarcinoma -1.900 2.6e-11
lung carcinoma -2.900 5.9e-20
malignant mesothelioma -4.800 2.0e-09
non-small cell lung cancer -1.552 1.4e-18
oligodendroglioma -1.300 3.3e-03
ovarian cancer -2.100 4.1e-11
pituitary cancer -1.300 1.1e-03
primitive neuroectodermal tumor -1.200 2.7e-03

Synonym

Accession Q9H2F9 B2R9I3
Symbols SE57-1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MTTVTVTTEIPPRDKMEDNSALYESTSAHIIEETEYVKKIRTTLQKIRTQMFKDEIRHDSTNHKLDAKHC      1 - 70
GNLQQGSDSEMDPSCCSLDLLMKKIKGKDLQLLEMNKENEVLKIKLQASREAGAAALRNVAQRLFENYQT     71 - 140
QSEEVRKKQEDSKQLLQVNKLEKEQKLKQHVENLNQVAEKLEEKHSQITELENLVQRMEKEKRTLLERKL    141 - 210
SLENKLLQLKSSATYGKSCQDLQREISILQEQISHLQFVIHSQHQNLRSVIQEMEGLKNNLKEQDKRIEN    211 - 280
LREKVNILEAQNKELKTQVALSSETPRTKVSKAVSTSELKTEGVSPYLMLIRLRK                   281 - 335
//

Text Mined References (12)

PMID Year Title