Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.38
PubTator Score 3.16

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
25381825 Data indicate coiled-coil domain containing 68 (CCDC68) as a tumor suppressor gene (TSG) in pancreatic ductal adenocarcinoma (PDAC).

AA Sequence

MTTVTVTTEIPPRDKMEDNSALYESTSAHIIEETEYVKKIRTTLQKIRTQMFKDEIRHDSTNHKLDAKHC      1 - 70
GNLQQGSDSEMDPSCCSLDLLMKKIKGKDLQLLEMNKENEVLKIKLQASREAGAAALRNVAQRLFENYQT     71 - 140
QSEEVRKKQEDSKQLLQVNKLEKEQKLKQHVENLNQVAEKLEEKHSQITELENLVQRMEKEKRTLLERKL    141 - 210
SLENKLLQLKSSATYGKSCQDLQREISILQEQISHLQFVIHSQHQNLRSVIQEMEGLKNNLKEQDKRIEN    211 - 280
LREKVNILEAQNKELKTQVALSSETPRTKVSKAVSTSELKTEGVSPYLMLIRLRK                   281 - 335
//

Text Mined References (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25381825 2015 Coiled-coil domain containing 68 (CCDC68) demonstrates a tumor-suppressive role in pancreatic ductal adenocarcinoma.
23453885 2013 Identification of risk loci with shared effects on five major psychiatric disorders: a genome-wide analysis.
21926974 2011 Genome-wide association study identifies five new schizophrenia loci.
21441570 2011 Genome-wide meta-analysis for severe diabetic retinopathy.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15142679 2004 Tissue expression and sero-reactivity of tumor-specific antigens in colorectal cancer.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...