Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.38
PubTator Score 3.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 5.86753609697059E-20
non-small cell lung cancer 2798 1.44316972362455E-18
lung adenocarcinoma 2714 2.61785451298519E-11
ovarian cancer 8492 4.06950685506245E-11
adrenocortical carcinoma 1427 3.63634337150363E-10
malignant mesothelioma 3163 1.96390241535355E-9
cystic fibrosis 1670 8.11265395333064E-6
pituitary cancer 1972 0.00106850625912217
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00226349456634486
primitive neuroectodermal tumor 3031 0.00272183395254282
oligodendroglioma 2849 0.00326900269956658
ependymoma 2514 0.00463624667382333
group 4 medulloblastoma 1875 0.00946473160742531
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0233749703514419
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0374167314603317
Disease Target Count Z-score Confidence
Basal ganglia calcification 17 3.402 1.7

Expression

Synonym

Accession Q9H2F9 B2R9I3
Symbols SE57-1

Gene

  Ortholog (12)

Gene RIF (1)

PMID Text
25381825 Data indicate coiled-coil domain containing 68 (CCDC68) as a tumor suppressor gene (TSG) in pancreatic ductal adenocarcinoma (PDAC).

AA Sequence

MTTVTVTTEIPPRDKMEDNSALYESTSAHIIEETEYVKKIRTTLQKIRTQMFKDEIRHDSTNHKLDAKHC      1 - 70
GNLQQGSDSEMDPSCCSLDLLMKKIKGKDLQLLEMNKENEVLKIKLQASREAGAAALRNVAQRLFENYQT     71 - 140
QSEEVRKKQEDSKQLLQVNKLEKEQKLKQHVENLNQVAEKLEEKHSQITELENLVQRMEKEKRTLLERKL    141 - 210
SLENKLLQLKSSATYGKSCQDLQREISILQEQISHLQFVIHSQHQNLRSVIQEMEGLKNNLKEQDKRIEN    211 - 280
LREKVNILEAQNKELKTQVALSSETPRTKVSKAVSTSELKTEGVSPYLMLIRLRK                   281 - 335
//

Text Mined References (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25381825 2015 Coiled-coil domain containing 68 (CCDC68) demonstrates a tumor-suppressive role in pancreatic ductal adenocarcinoma.
23453885 2013 Identification of risk loci with shared effects on five major psychiatric disorders: a genome-wide analysis.
21926974 2011 Genome-wide association study identifies five new schizophrenia loci.
21441570 2011 Genome-wide meta-analysis for severe diabetic retinopathy.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15142679 2004 Tissue expression and sero-reactivity of tumor-specific antigens in colorectal cancer.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...