Property Summary

NCBI Gene PubMed Count 31
Grant Count 20
R01 Count 19
Funding $1,570,798.69
PubMed Score 16.91
PubTator Score 26.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Rheumatoid Arthritis 2.600 0.002
hepatocellular carcinoma -1.200 0.003
osteosarcoma -1.162 0.000
group 3 medulloblastoma 1.800 0.001
tuberculosis and treatment for 6 months 1.500 0.000
Breast cancer -1.700 0.000
ovarian cancer -1.500 0.000

Gene RIF (7)

PMID Text
26350215 Epigenetic factor EPC1 is a master regulator of DNA damage response by interacting with E2F1 to silence death and activate metastasis-related gene signatures
25755723 Silencing EPC1 by short hairpin RNA technology had the inhibition effects on cell proliferation and tumor growth in lung cancer
24166297 EPC1 and EPC2 are components of a complex that directly or indirectly serves to prevent MYC accumulation and AML cell apoptosis, thus sustaining oncogenic potential
19484761 SNP array CGH analysis of the breakpoint region in 3 ATLL-related cell lines and 4 patient samples revealed the chromosomal breakpoints are localized within the EPC1 gene locus in an ATLL-derived cell line (SO4) and in one patient with acute-type ATLL.
18984674 Observational study of gene-disease association. (HuGE Navigator)
17192267 Epc1 plays a role in the initiation of skeletal muscle differentiation, and its interaction with Hop is required for the full activity.
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSKLSFRARALDASKPLPVFRCEDLPDLHEYASINRAVPQMPTGMEKEEESEHHLQRAISAQQVYGEKRD      1 - 70
NMVIPVPEAESNIAYYESIYPGEFKMPKQLIHIQPFSLDAEQPDYDLDSEDEVFVNKLKKKMDICPLQFE     71 - 140
EMIDRLEKGSGQQPVSLQEAKLLLKEDDELIREVYEYWIKKRKNCRGPSLIPSVKQEKRDGSSTNDPYVA    141 - 210
FRRRTEKMQTRKNRKNDEASYEKMLKLRRDLSRAVTILEMIKRREKSKRELLHLTLEIMEKRYNLGDYNG    211 - 280
EIMSEVMAQRQPMKPTYAIPIIPITNSSQFKHQEAMDVKEFKVNKQDKADLIRPKRKYEKKPKVLPSSAA    281 - 350
ATPQQTSPAALPVFNAKDLNQYDFPSSDEEPLSQVLSGSSEAEEDNDPDGPFAFRRKAGCQYYAPHLDQT    351 - 420
GNWPWTSPKDGGLGDVRYRYCLTTLTVPQRCIGFARRRVGRGGRVLLDRAHSDYDSVFHHLDLEMLSSPQ    421 - 490
HSPVNQFANTSETNTSDKSFSKDLSQILVNIKSCRWRHFRPRTPSLHDSDNDELSCRKLYRSINRTGTAQ    491 - 560
PGTQTCSTSTQSKSSSGSAHFAFTAEQYQQHQQQLALMQKQQLAQIQQQQANSNSSTNTSQNLASNQQKS    561 - 630
GFRLNIQGLERTLQGFVSKTLDSASAQFAASALVTSEQLMGFKMKDDVVLGIGVNGVLPASGVYKGLHLS    631 - 700
STTPTALVHTSPSTAGSALLQPSNITQTSSSHSALSHQVTAANSATTQVLIGNNIRLTVPSSVATVNSIA    701 - 770
PINARHIPRTLSAVPSSALKLAAAANCQVSKVPSSSSVDSVPRENHESEKPALNNIADNTVAMEVT        771 - 836
//

Text Mined References (35)

PMID Year Title
26350215 2016 Epigenetic factor EPC1 is a master regulator of DNA damage response by interacting with E2F1 to silence death and activate metastasis-related gene signatures.
25787250 2015 Neomorphic effects of recurrent somatic mutations in Yin Yang 1 in insulin-producing adenomas.
25755723 2015 RNA interference targeting enhancer of polycomb1 exerts anti-tumor effects in lung cancer.
25416956 2014 A proteome-scale map of the human interactome network.
24166297 2014 Enhancers of Polycomb EPC1 and EPC2 sustain the oncogenic potential of MLL leukemia stem cells.
24159190 2014 Genome-wide association study on dimethylarginines reveals novel AGXT2 variants associated with heart rate variability but not with overall mortality.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23103869 2012 Pancreatic cancer genomes reveal aberrations in axon guidance pathway genes.
22509378 2012 A genome-wide association study of female sexual dysfunction.
19484761 2009 Alteration of enhancer of polycomb 1 at 10p11.2 is one of the genetic events leading to development of adult T-cell leukemia/lymphoma.
More...