Property Summary

NCBI Gene PubMed Count 22
PubMed Score 128.21
PubTator Score 15.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
adrenocortical carcinoma -3.204 1.3e-06
astrocytic glioma 3.100 2.0e-03
Atopic dermatitis -1.100 4.9e-03
atypical teratoid / rhabdoid tumor 1.600 3.8e-03
Breast cancer -3.100 1.5e-12
breast carcinoma -1.300 2.5e-16
colon cancer -2.000 2.6e-02
Crohn's disease -1.373 1.1e-02
ductal carcinoma in situ -1.700 1.2e-03
glioblastoma 1.400 5.1e-05
group 3 medulloblastoma -1.700 1.3e-02
intraductal papillary-mucinous adenoma (... -1.700 9.3e-04
intraductal papillary-mucinous neoplasm ... -1.400 1.0e-02
invasive ductal carcinoma -1.186 1.5e-03
lung adenocarcinoma -2.300 3.5e-15
lung carcinoma -2.800 2.4e-12
medulloblastoma, large-cell 1.300 6.4e-04
nasopharyngeal carcinoma 1.100 2.6e-02
non-small cell lung cancer -1.069 1.3e-10
oligodendroglioma 2.700 2.8e-03
osteosarcoma -2.430 1.3e-04
ovarian cancer -1.700 4.6e-13
posterior fossa group B ependymoma -1.200 1.9e-04
primitive neuroectodermal tumor 1.800 1.3e-02
psoriasis -2.600 3.5e-05
ulcerative colitis -2.007 1.8e-03
Waldenstrons macroglobulinemia -1.062 3.1e-03

Gene RIF (10)

AA Sequence

MRSEALLLYFTLLHFAGAGFPEDSEPISISHGNYTKQYPVFVGHKPGRNTTQRHRLDIQMIMIMNGTLYI      1 - 70
AARDHIYTVDIDTSHTEEIYCSKKLTWKSRQADVDTCRMKGKHKDECHNFIKVLLKKNDDALFVCGTNAF     71 - 140
NPSCRNYKMDTLEPFGDEFSGMARCPYDAKHANVALFADGKLYSATVTDFLAIDAVIYRSLGESPTLRTV    141 - 210
KHDSKWLKEPYFVQAVDYGDYIYFFFREIAVEYNTMGKVVFPRVAQVCKNDMGGSQRVLEKQWTSFLKAR    211 - 280
LNCSVPGDSHFYFNILQAVTDVIRINGRDVVLATFSTPYNSIPGSAVCAYDMLDIASVFTGRFKEQKSPD    281 - 350
STWTPVPDERVPKPRPGCCAGSSSLERYATSNEFPDDTLNFIKTHPLMDEAVPSIFNRPWFLRTMVRYRL    351 - 420
TKIAVDTAAGPYQNHTVVFLGSEKGIILKFLARIGNSGFLNDSLFLEEMSVYNSEKCSYDGVEDKRIMGM    421 - 490
QLDRASSSLYVAFSTCVIKVPLGRCERYGKCKKTCIASRDPYCGWIKEGGACSHLSPNSRLTFEQDIERG    491 - 560
NTDGLGDCHNSFVALNGHSSSLLPSTTTSDSTAQEGYESRGGMLDWKHLLDSPDSTDPLGAVSSHNHQDK    561 - 630
KGVIRESYLKGHDQLVPVTLLAIAVILAFVMGAVFSGITVYCVCDHRRKDVAVVQRKEKELTHSRRGSMS    631 - 700
SVTKLSGLFGDTQSKDPKPEAILTPLMHNGKLATPGNTAKMLIKADQHHLDLTALPTPESTPTLQQKRKP    701 - 770
SRGSREWERNQNLINACTKDMPPMGSPVIPTDLPLRASPSHIPSVVVLPITQQGYQHEYVDQPKMSEVAQ    771 - 840
MALEDQAATLEYKTIKEHLSSKSPNHGVNLVENLDSLPPKVPQREASLGPPGASLSQTGLSKRLEMHHSS    841 - 910
SYGVDYKRSYPTNSLTRSHQATTLKRNNTNSSNSSHLSRNQSFGRGDNPPPAPQRVDSIQVHSSQPSGQA    911 - 980
VTVSRQPSLNAYNSLTRSGLKRTPSLKPDVPPKPSFAPLSTSMKPNDACT                        981 - 1030
//

Text Mined References (24)

PMID Year Title