Property Summary

NCBI Gene PubMed Count 13
Grant Count 15
R01 Count 10
Funding $6,914,462.17
PubMed Score 16.42
PubTator Score 20.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Multiple myeloma 1.054 0.012
astrocytic glioma -1.400 0.035
diabetes mellitus -1.200 0.007
primary Sjogren syndrome 1.100 0.007
nasopharyngeal carcinoma 1.100 0.003
Pick disease -1.400 0.000
ovarian cancer 2.700 0.000
Breast cancer 1.100 0.000

Gene RIF (5)

PMID Text
24354357 SLC25A32 gene polymorphism could be a risk factor for lower folate concentration and future fracture.
23266187 Compares and contrasts all the known human SLC25A* genes and includes functional information.
21768094 identified residues in the walls and at the base of the transport cavity that are involved in substrate recognition by the MFT
20877624 Observational study of gene-disease association. (HuGE Navigator)
19362304 Patient with SLC25A32 deficiency was able to have a successful pregnancy after fertilization in vitro.

AA Sequence

MTGQGQSASGSSAWSTVFRHVRYENLIAGVSGGVLSNLALHPLDLVKIRFAVSDGLELRPKYNGILHCLT      1 - 70
TIWKLDGLRGLYQGVTPNIWGAGLSWGLYFFFYNAIKSYKTEGRAERLEATEYLVSAAEAGAMTLCITNP     71 - 140
LWVTKTRLMLQYDAVVNSPHRQYKGMFDTLVKIYKYEGVRGLYKGFVPGLFGTSHGALQFMAYELLKLKY    141 - 210
NQHINRLPEAQLSTVEYISVAALSKIFAVAATYPYQVVRARLQDQHMFYSGVIDVITKTWRKEGVGGFYK    211 - 280
GIAPNLIRVTPACCITFVVYENVSHFLLDLREKRK                                       281 - 315
//

Text Mined References (15)

PMID Year Title
26933868 2016 SLC25A32 Mutations and Riboflavin-Responsive Exercise Intolerance.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24354357 2014 Polymorphism of SLC25A32, the folate transporter gene, is associated with plasma folate levels and bone fractures in Japanese postmenopausal women.
23266187 The mitochondrial transporter family SLC25: identification, properties and physiopathology.
21956163 2012 Effect of chronic alcohol exposure on folate uptake by liver mitochondria.
21768094 2011 Tetrahydrofolate recognition by the mitochondrial folate transporter.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19362304 2009 Mitochondrial fatty acid transport enzyme deficiency--implications for in vitro fertilization.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...