Property Summary

NCBI Gene PubMed Count 14
PubMed Score 19.70
PubTator Score 20.52

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.400 3.5e-02
Breast cancer 1.100 3.2e-04
diabetes mellitus -1.200 6.8e-03
Multiple myeloma 1.054 1.2e-02
nasopharyngeal carcinoma 1.100 2.6e-03
ovarian cancer 2.700 1.2e-06
Pick disease -1.400 2.2e-04
primary Sjogren syndrome 1.100 6.5e-03

Gene RIF (6)

AA Sequence

MTGQGQSASGSSAWSTVFRHVRYENLIAGVSGGVLSNLALHPLDLVKIRFAVSDGLELRPKYNGILHCLT      1 - 70
TIWKLDGLRGLYQGVTPNIWGAGLSWGLYFFFYNAIKSYKTEGRAERLEATEYLVSAAEAGAMTLCITNP     71 - 140
LWVTKTRLMLQYDAVVNSPHRQYKGMFDTLVKIYKYEGVRGLYKGFVPGLFGTSHGALQFMAYELLKLKY    141 - 210
NQHINRLPEAQLSTVEYISVAALSKIFAVAATYPYQVVRARLQDQHMFYSGVIDVITKTWRKEGVGGFYK    211 - 280
GIAPNLIRVTPACCITFVVYENVSHFLLDLREKRK                                       281 - 315
//

Text Mined References (16)

PMID Year Title