Property Summary

NCBI Gene PubMed Count 12
PubMed Score 21.54
PubTator Score 6.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
EPILEPTIC ENCEPHALOPATHY, EARLY INFANTILE, 38 1 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 2.6e-06
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Epilepsy 792 0.0 4.0

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer -1.300 2.6e-06

 GO Function (1)

Gene RIF (6)

AA Sequence

MGNGGRSGLQQGKGNVDGVAATPTAASASCQYRCIECNQEAKELYRDYNHGVLKITICKSCQKPVDKYIE      1 - 70
YDPVIILINAILCKAQAYRHILFNTQINIHGKLCIFCLLCEAYLRWWQLQDSNQNTAPDDLIRYAKEWDF     71 - 140
YRMFAIAALEQTAYFIGIFTFLWVERPMTAKKKPNFILLLKALLLSSYGKLLLIPAVIWEHDYTSVCLKL    141 - 210
IKVFVLTSNFQAIRVTLNINRKLSFLAVLSGLLLESIMVYFFQSMEWDVGSDYAIFKSQDF             211 - 271
//

Text Mined References (14)

PMID Year Title