Property Summary

NCBI Gene PubMed Count 6
PubMed Score 15.83
PubTator Score 4.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Bipolar Disorder 666
Disease Target Count P-value
psoriasis 6694 1.3e-02
Disease Target Count Z-score Confidence
Keratosis follicularis 3 4.2 2.1

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.100 1.3e-02

Gene RIF (3)

AA Sequence

MMVHCAGCERPILDRFLLNVLDRAWHIKCVQCCECKTNLSEKCFSREGKLYCKNDFFRRFGTKCAGCAQG      1 - 70
ISPSDLVRKARSKVFHLNCFTCMVCNKQLSTGEELYVIDENKFVCKDDYLSSSSLKEGSLNSVSSCTDRS     71 - 140
LSPDLQDALQDDPKETDNSTSSDKETANNENEEQNSGTKRRGPRTTIKAKQLETLKAAFAATPKPTRHIR    141 - 210
EQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALGARRHAFFRSPRRMRPLGGRLDESEMLGSTPYTYYG    211 - 280
DYQGDYYAPGSNYDFFAHGPPSQAQSPADSSFLAASGPGSTPLGALEPPLAGPHAADNPRFTDMISHPDT    281 - 350
PSPEPGLPGTLHPMPGEVFSGGPSPPFPMSGTSGYSGPLSHPNPELNEAAVW                      351 - 402
//

Text Mined References (6)

PMID Year Title