Property Summary

NCBI Gene PubMed Count 6
Grant Count 2
R01 Count 1
Funding $264,419.4
PubMed Score 15.74
PubTator Score 4.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Keratosis Follicularis 3 4.172 2.1
psoriasis 6,685

Gene RIF (3)

PMID Text
12782966 Variation is not a highly penetrant autosomal dominant susceptibility locus for mood disorder in families.
11566211 In mice, this protein is involved in learning and motor functions.
10325223 In mice, this protein is essential for the regulation of precursor cell proliferation and the control of neuronal differentiation and migration during hippocampal development.

AA Sequence

MMVHCAGCERPILDRFLLNVLDRAWHIKCVQCCECKTNLSEKCFSREGKLYCKNDFFRRFGTKCAGCAQG      1 - 70
ISPSDLVRKARSKVFHLNCFTCMVCNKQLSTGEELYVIDENKFVCKDDYLSSSSLKEGSLNSVSSCTDRS     71 - 140
LSPDLQDALQDDPKETDNSTSSDKETANNENEEQNSGTKRRGPRTTIKAKQLETLKAAFAATPKPTRHIR    141 - 210
EQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALGARRHAFFRSPRRMRPLGGRLDESEMLGSTPYTYYG    211 - 280
DYQGDYYAPGSNYDFFAHGPPSQAQSPADSSFLAASGPGSTPLGALEPPLAGPHAADNPRFTDMISHPDT    281 - 350
PSPEPGLPGTLHPMPGEVFSGGPSPPFPMSGTSGYSGPLSHPNPELNEAAVW                      351 - 402
//

Text Mined References (6)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12782966 2003 Mutational analysis of two positional candidate susceptibility genes for bipolar disorder on chromosome 12q23-q24: phenylalanine hydroxylase and human LIM-homeobox LHX5.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11566211 2001 Learning impairments and motor dysfunctions in adult Lhx5-deficient mice displaying hippocampal disorganization.
11137295 2000 Genomic structure, chromosomal localization and expression of the human LIM-homeobox gene LHX5.
10325223 1999 Control of hippocampal morphogenesis and neuronal differentiation by the LIM homeobox gene Lhx5.