Property Summary

NCBI Gene PubMed Count 10
Grant Count 5
Funding $342,844.4
PubMed Score 19.26
PubTator Score 12.48

Knowledge Summary

Patent (11,881)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.642 0.000
lung adenocarcinoma 1.500 0.000

Synonym

Accession Q9H2B4 A8K9N2 Q7Z5R3 Q96BK0 SAT-1
Symbols CAON
EDM4
SAT1
SAT-1

Gene

PANTHER Protein Class (1)

Gene RIF (6)

PMID Text
24250268 Screened the SLC26A1 gene in a cohort of 13 individuals with recurrent calcium oxalate urolithiasis, which is the commonest type. DNA sequence analyses showed missense mutations in seven patients.
23815884 SLC26A1 protein,point mutation is highly responsible for the hearing loss of newborns.
21093948 The oxalate precursor glyoxylate was identified as a substrate of sat-1. Upregulated expression of sat-1 mRNA and of sat-1 protein indicates that glyoxylate may be responsible for the elevated oxalate release from hepatocytes observed in hyperoxaluria.
17881426 No mutation was found in the coding regions and intron-exon boundaries of the genes for CA II, CA IV, CA XIV, kNCB1, NHE3, NHE8, NHRF1, NHRF2 and SLC26A6 amplified from genomic DNA of family members with pRTA.
17119850 The expression of three messengers coding for SAT-1, SAT-2 and GalNAcT-1 in human samples of intestinal cancer and some cell lines (breast cancer and melanomas), was evaluated.
12713736 Characterization of the SAT1 gene and protein function.

AA Sequence

MDESPEPLQQGRGPVPVRRQRPAPRGLREMLKARLWCSCSCSVLCVRALVQDLLPATRWLRQYRPREYLA      1 - 70
GDVMSGLVIGIILVPQAIAYSLLAGLQPIYSLYTSFFANLIYFLMGTSRHVSVGIFSLLCLMVGQVVDRE     71 - 140
LQLAGFDPSQDGLQPGANSSTLNGSAAMLDCGRDCYAIRVATALTLMTGLYQVLMGVLRLGFVSAYLSQP    141 - 210
LLDGFAMGASVTILTSQLKHLLGVRIPRHQGPGMVVLTWLSLLRGAGQANVCDVVTSTVCLAVLLAAKEL    211 - 280
SDRYRHRLRVPLPTELLVIVVATLVSHFGQLHKRFGSSVAGDIPTGFMPPQVPEPRLMQRVALDAVALAL    281 - 350
VAAAFSISLAEMFARSHGYSVRANQELLAVGCCNVLPAFLHCFATSAALAKSLVKTATGCRTQLSSVVSA    351 - 420
TVVLLVLLALAPLFHDLQRSVLACVIVVSLRGALRKVWDLPRLWRMSPADALVWAGTAATCMLVSTEAGL    421 - 490
LAGVILSLLSLAGRTQRPRTALLARIGDTAFYEDATEFEGLVPEPGVRVFRFGGPLYYANKDFFLQSLYS    491 - 560
LTGLDAGCMAARRKEGGSETGVGEGGPAQGEDLGPVSTRAALVPAAAGFHTVVIDCAPLLFLDAAGVSTL    561 - 630
QDLRRDYGALGISLLLACCSPPVRDILSRGGFLGEGPGDTAEEEQLFLSVHDAVQTARARHRELEATDAH    631 - 700
L//

Text Mined References (14)

PMID Year Title
24647542 2014 N-glycosylation and topology of the human SLC26 family of anion transport membrane proteins.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24250268 2013 Human SLC26A1 gene variants: a pilot study.
23815884 2013 Newborn genetic screening for high risk deafness-associated mutations with a new Tetra-primer ARMS PCR kit.
21093948 2011 Glyoxylate is a substrate of the sulfate-oxalate exchanger, sat-1, and increases its expression in HepG2 cells.
17881426 2008 Familial pure proximal renal tubular acidosis--a clinical and genetic study.
17119850 2007 Evaluation of SAT-1, SAT-2 and GalNAcT-1 mRNA in colon cancer by real-time PCR.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...