Property Summary

NCBI Gene PubMed Count 14
PubMed Score 21.78
PubTator Score 17.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Peeling skin syndrome 17 4.655 2.3
Disease Target Count P-value
psoriasis 6694 3.4e-14
ependymoma 4679 1.6e-08
atypical teratoid / rhabdoid tumor 5112 1.3e-05
fibroadenoma 559 2.0e-03
breast carcinoma 1637 3.8e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Schizophrenia 1160 0.0 1.9
Disease Target Count Z-score Confidence
Periarthritis 6 4.096 2.0
Clubfoot 39 3.848 1.9
Raynaud disease 6 3.121 1.6
Disease Target Count
PEELING SKIN SYNDROME 3 1

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 1.3e-05
breast carcinoma 1.700 3.8e-03
ependymoma -1.100 1.6e-08
fibroadenoma 1.400 2.0e-03
psoriasis -1.200 3.4e-14

Gene RIF (7)

AA Sequence

MTLRPGTMRLACMFSSILLFGAAGLLLFISLQDPTELAPQQVPGIKFNIRPRQPHHDLPPGGSQDGDLKE      1 - 70
PTERVTRDLSSGAPRGRNLPAPDQPQPPLQRGTRLRLRQRRRRLLIKKMPAAATIPANSSDAPFIRPGPG     71 - 140
TLDGRWVSLHRSQQERKRVMQEACAKYRASSSRRAVTPRHVSRIFVEDRHRVLYCEVPKAGCSNWKRVLM    141 - 210
VLAGLASSTADIQHNTVHYGSALKRLDTFDRQGILHRLSTYTKMLFVREPFERLVSAFRDKFEHPNSYYH    211 - 280
PVFGKAILARYRANASREALRTGSGVRFPEFVQYLLDVHRPVGMDIHWDHVSRLCSPCLIDYDFVGKFES    281 - 350
MEDDANFFLSLIRAPRNLTFPRFKDRHSQEARTTARIAHQYFAQLSALQRQRTYDFYYMDYLMFNYSKPF    351 - 420
ADLY                                                                      421 - 424
//

Text Mined References (15)

PMID Year Title