Property Summary

NCBI Gene PubMed Count 121
Grant Count 45
R01 Count 19
Funding $5,932,598.34
PubMed Score 154.13
PubTator Score 170.25

Knowledge Summary

Patent

No data available

Expression

Gene RIF (116)

PMID Text
26796342 Cell proliferation enhancing and anti-apoptosis activity requires the intracellular domain and apparently the dimerization of the transmembrane chemokine ligand.
26708384 Wnt5a-Ror2 signaling enhances expression and secretion of CXCL16 in mesenchymal stem cells thereby activating CXCR6 expressed on tumor cells to promote proliferation.
26707275 Our data suggest that CXCL16 induces angiogenesis in autocrine manner via ERK, Akt, p38 pathways and HIF-1alpha modulation
26621504 In conclusion, rheumatoid arthritis synovial fibroblasts were activated by CXCL16 to produce RANKL via pathways involving JAK2/STAT3 and p38/MAPK
26345917 HMGB-1, CXCL16, miRNA-30a, and urinary TGF-ss1 were highly expressed in PNS patients and may play important roles in the pathogenesis and development of PNS.
26272362 high protein expression of CXCL16 and high protein co-expression of CXCL16/CXCR6 in prostate cancer were independent predictors for a worse clinical outcome
26058873 These results indicate that MEK inhibitor diminishes Nasopharyngeal carcinoma cell proliferation and NPC-induced osteoclastogenesis via modulating CCL2 and CXCL16 expressions.
26045830 PPARG rs1152002, AGTR1 rs5186, CXCL16 rs3744700 and LGALS2 rs7291467 polymorphisms may be closely related to the development of coronary heart disease
26021984 we examined the expression of CXCL16 and CXCR6 and their relations to prognosis in 335 unselected patients with NSCLC, and investigated possible relationships with our previously studied immunologic and angiogenic markers
25904061 Endothelial CXCL16's action on platelets is not limited to platelet activation. Immobilised CXCL16 also acts as a potent novel platelet adhesion ligand, inducing platelet adhesion to the human vessel wall.
More...

AA Sequence

MGRDLRPGSRVLLLLLLLLLVYLTQPGNGNEGSVTGSCYCGKRISSDSPPSVQFMNRLRKHLRAYHRCLY      1 - 70
YTRFQLLSWSVCGGNKDPWVQELMSCLDLKECGHAYSGIVAHQKHLLPTSPPISQASEGASSDIHTPAQM     71 - 140
LLSTLQSTQRPTLPVGSLSSDKELTRPNETTIHTAGHSLAAGPEAGENQKQPEKNAGPTARTSATVPVLC    141 - 210
LLAIIFILTAALSYVLCKRRRGQSPQSSPDLPVHYIPVAPDSNT                              211 - 254
//

Text Mined References (121)

PMID Year Title
26796342 2016 Transmembrane chemokines act as receptors in a novel mechanism termed inverse signaling.
26708384 2016 Wnt5a-Ror2 signaling in mesenchymal stem cells promotes proliferation of gastric cancer cells by activating CXCL16-CXCR6 axis.
26707275 2016 CXCL16 induces angiogenesis in autocrine signaling pathway involving hypoxia-inducible factor 1? in human umbilical vein endothelial cells.
26621504 2016 CXCL16 upregulates RANKL expression in rheumatoid arthritis synovial fibroblasts through the JAK2/STAT3 and p38/MAPK signaling pathway.
26345917 2015 Analysis of the expression of HMGB-1, CXCL16, miRNA-30a, and TGF-?1 in primary nephritic syndrome patients and its significance.
26272362 2015 The prognostic significance of CXCL16 and its receptor C-X-C chemokine receptor 6 in prostate cancer.
26058873 2015 MEK inhibitor diminishes nasopharyngeal carcinoma (NPC) cell growth and NPC-induced osteoclastogenesis via modulating CCL2 and CXCL16 expressions.
26045830 2015 PPARG, AGTR1, CXCL16 and LGALS2 polymorphisms are correlated with the risk for coronary heart disease.
26021984 2015 Prognostic impact of CXCL16 and CXCR6 in non-small cell lung cancer: combined high CXCL16 expression in tumor stroma and cancer cells yields improved survival.
25904061 2015 Platelets from flowing blood attach to the inflammatory chemokine CXCL16 expressed in the endothelium of the human vessel wall.
More...