Property Summary

NCBI Gene PubMed Count 133
PubMed Score 170.42
PubTator Score 170.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
active ulcerative colitis 2.452 3.3e-03
adult high grade glioma 1.500 1.2e-02
Astrocytoma, Pilocytic 1.900 1.8e-08
glioblastoma 1.300 1.7e-04
group 3 medulloblastoma -1.100 1.8e-02
intraductal papillary-mucinous carcinoma... 2.200 4.3e-03
intraductal papillary-mucinous neoplasm ... 2.400 1.0e-02
lung carcinoma -2.500 9.5e-18
non-small cell lung cancer -1.452 1.1e-14
osteosarcoma -1.273 4.2e-02
ovarian cancer 2.700 3.8e-07
pancreatic cancer 1.600 1.8e-02
posterior fossa group A ependymoma 1.300 1.4e-07
primary pancreatic ductal adenocarcinoma 1.443 2.7e-02
tuberculosis -1.900 1.9e-04

Gene RIF (128)

AA Sequence

MGRDLRPGSRVLLLLLLLLLVYLTQPGNGNEGSVTGSCYCGKRISSDSPPSVQFMNRLRKHLRAYHRCLY      1 - 70
YTRFQLLSWSVCGGNKDPWVQELMSCLDLKECGHAYSGIVAHQKHLLPTSPPISQASEGASSDIHTPAQM     71 - 140
LLSTLQSTQRPTLPVGSLSSDKELTRPNETTIHTAGHSLAAGPEAGENQKQPEKNAGPTARTSATVPVLC    141 - 210
LLAIIFILTAALSYVLCKRRRGQSPQSSPDLPVHYIPVAPDSNT                              211 - 254
//

Text Mined References (133)

PMID Year Title