Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.73
PubTator Score 2.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
nephrosclerosis -1.912 0.027
gastric cancer 1.400 0.004
pancreatic cancer 1.100 0.015
malignant mesothelioma -1.600 0.000
ependymoma -2.200 0.000
glioblastoma -2.400 0.000
atypical teratoid / rhabdoid tumor -2.100 0.000
medulloblastoma, large-cell -2.300 0.000
primitive neuroectodermal tumor -1.400 0.027
adult high grade glioma -1.900 0.002
pilocytic astrocytoma -1.500 0.001
pancreatic carcinoma 1.100 0.015
ovarian cancer -1.400 0.000

Synonym

Accession Q9H2A2 B7Z521 O60793 Q24JS9 Q53GT3 Q5TI80
Symbols ALDH12
DJ352A20.2

Gene

PANTHER Protein Class (2)

Gene RIF (2)

PMID Text
22082156 Knockdown of aldehyde dehydrogenase 8 family, member A1 (ALDH8A1) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
19343046 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAGTNALLMLENFIDGKFLPCSSYIDSYDPSTGEVYCRVPNSGKDEIEAAVKAAREAFPSWSSRSPQERS      1 - 70
RVLNQVADLLEQSLEEFAQAESKDQGKTLALARTMDIPRSVQNFRFFASSSLHHTSECTQMDHLGCMHYT     71 - 140
VRAPVGVAGLISPWNLPLYLLTWKIAPAMAAGNTVIAKPSELTSVTAWMLCKLLDKAGVPPGVVNIVFGT    141 - 210
GPRVGEALVSHPEVPLISFTGSQPTAERITQLSAPHCKKLSLELGGKNPAIIFEDANLDECIPATVRSSF    211 - 280
ANQGEICLCTSRIFVQKSIYSEFLKRFVEATRKWKVGIPSDPLVSIGALISKAHLEKVRSYVKRALAEGA    281 - 350
QIWCGEGVDKLSLPARNQAGYFMLPTVITDIKDESCCMTEEIFGPVTCVVPFDSEEEVIERANNVKYGLA    351 - 420
ATVWSSNVGRVHRVAKKLQSGLVWTNCWLIRELNLPFGGMKSSGIGREGAKDSYDFFTEIKTITVKH       421 - 487
//

Text Mined References (11)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23870195 2013 Genetics of coronary artery calcification among African Americans, a meta-analysis.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11007799 2000 cDNA cloning and expression of a human aldehyde dehydrogenase (ALDH) active with 9-cis-retinal and identification of a rat ortholog, ALDH12.
More...