Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.81
PubTator Score 2.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.900 2.1e-03
Astrocytoma, Pilocytic -1.600 3.8e-04
atypical teratoid / rhabdoid tumor -2.100 2.1e-04
ependymoma -2.200 6.3e-11
gastric cancer 1.400 3.8e-03
glioblastoma -1.400 8.9e-04
malignant mesothelioma -1.600 9.4e-05
medulloblastoma, large-cell -2.300 3.5e-04
nephrosclerosis -1.912 2.7e-02
ovarian cancer -1.400 5.0e-04
pancreatic cancer 1.100 1.5e-02
pancreatic carcinoma 1.100 1.5e-02
primitive neuroectodermal tumor -1.400 2.7e-02

Gene RIF (2)

AA Sequence

MAGTNALLMLENFIDGKFLPCSSYIDSYDPSTGEVYCRVPNSGKDEIEAAVKAAREAFPSWSSRSPQERS      1 - 70
RVLNQVADLLEQSLEEFAQAESKDQGKTLALARTMDIPRSVQNFRFFASSSLHHTSECTQMDHLGCMHYT     71 - 140
VRAPVGVAGLISPWNLPLYLLTWKIAPAMAAGNTVIAKPSELTSVTAWMLCKLLDKAGVPPGVVNIVFGT    141 - 210
GPRVGEALVSHPEVPLISFTGSQPTAERITQLSAPHCKKLSLELGGKNPAIIFEDANLDECIPATVRSSF    211 - 280
ANQGEICLCTSRIFVQKSIYSEFLKRFVEATRKWKVGIPSDPLVSIGALISKAHLEKVRSYVKRALAEGA    281 - 350
QIWCGEGVDKLSLPARNQAGYFMLPTVITDIKDESCCMTEEIFGPVTCVVPFDSEEEVIERANNVKYGLA    351 - 420
ATVWSSNVGRVHRVAKKLQSGLVWTNCWLIRELNLPFGGMKSSGIGREGAKDSYDFFTEIKTITVKH       421 - 487
//

Text Mined References (11)

PMID Year Title