Property Summary

NCBI Gene PubMed Count 14
Grant Count 4
R01 Count 4
Funding $147,260.83
PubMed Score 6.00
PubTator Score 9.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Rheumatoid Arthritis -1.100 0.039
malignant mesothelioma -1.200 0.000
glioblastoma 1.200 0.007
Duchenne muscular dystrophy 1.302 0.000
limb girdle muscular dystrophy 2I 1.161 0.000
Becker muscular dystrophy 1.175 0.000
primary pancreatic ductal adenocarcinoma 1.268 0.031
lung cancer -1.400 0.001
ovarian cancer 1.700 0.000
pancreatic cancer 1.200 0.028

Synonym

Accession Q9H299 Q5T122
Symbols TIP-B1
SH3BP-1
HEL-S-297

Gene

PDB

1SJ6  

Gene RIF (2)

PMID Text
26286913 SH3BGRL3 is a novel urinary biomarker for urothelial carcinoma. Evaluation of SH3BGRL3 expression status may identify a subset of patients with urothelial carcinoma for cotargeting candidates in the design of EGFR-based cancer therapies.
15907482 SH3BGRL3 may function as a regulator in all-trans retinoic acid-induced pathway

AA Sequence

MSGLRVYSTSVTGSREIKSQQSEVTRILDGKRIQYQLVDISQDNALRDEMRALAGNPKATPPQIVNGDQY      1 - 70
CGDYELFVEAVEQNTLQEFLKLA                                                    71 - 93
//

Text Mined References (20)

PMID Year Title
26286913 2015 SH3BGRL3 Protein as a Potential Prognostic Biomarker for Urothelial Carcinoma: A Novel Binding Partner of Epidermal Growth Factor Receptor.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24841563 2014 An image-based RNAi screen identifies SH3BP1 as a key effector of Semaphorin 3E-PlexinD1 signaling.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
More...