Property Summary

NCBI Gene PubMed Count 14
PubMed Score 6.00
PubTator Score 9.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Rheumatoid Arthritis -1.100 3.9e-02
malignant mesothelioma -1.200 2.3e-06
glioblastoma 1.200 7.4e-03
Duchenne muscular dystrophy 1.302 1.8e-10
limb girdle muscular dystrophy 2I 1.161 1.7e-05
Becker muscular dystrophy 1.175 3.6e-05
primary pancreatic ductal adenocarcinoma 1.268 3.1e-02
lung cancer -1.400 8.0e-04
ovarian cancer 1.700 1.6e-05
pancreatic cancer 1.200 2.8e-02

Synonym

Accession Q9H299 Q5T122
Symbols TIP-B1
SH3BP-1
HEL-S-297

Gene

PDB

1SJ6  

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
26286913 SH3BGRL3 is a novel urinary biomarker for urothelial carcinoma. Evaluation of SH3BGRL3 expression status may identify a subset of patients with urothelial carcinoma for cotargeting candidates in the design of EGFR-based cancer therapies.
15907482 SH3BGRL3 may function as a regulator in all-trans retinoic acid-induced pathway

AA Sequence

MSGLRVYSTSVTGSREIKSQQSEVTRILDGKRIQYQLVDISQDNALRDEMRALAGNPKATPPQIVNGDQY      1 - 70
CGDYELFVEAVEQNTLQEFLKLA                                                    71 - 93
//

Text Mined References (20)

PMID Year Title
26286913 2015 SH3BGRL3 Protein as a Potential Prognostic Biomarker for Urothelial Carcinoma: A Novel Binding Partner of Epidermal Growth Factor Receptor.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24841563 2014 An image-based RNAi screen identifies SH3BP1 as a key effector of Semaphorin 3E-PlexinD1 signaling.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15907482 2005 NMR structure and regulated expression in APL cell of human SH3BGRL3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11444877 2001 A novel human homologue of the SH3BGR gene encodes a small protein similar to Glutaredoxin 1 of Escherichia coli.
11344125 2001 Changes in cytosolic and membrane TNF inhibitory protein-B1 (TIP-B1) levels associated with protection from TNF-induced cytotoxicity.
11211881 2000 Identification of novel genes differentially expressed in PMA-induced HL-60 cells using cDNA microarrays.
11137621 2000 A novel tumor necrosis factor-alpha inhibitory protein, TIP-B1.
10554026 1999 Identification, characterization, and cloning of TIP-B1, a novel protein inhibitor of tumor necrosis factor-induced lysis.