Property Summary

NCBI Gene PubMed Count 22
Grant Count 18
R01 Count 16
Funding $1,561,026.05
PubMed Score 89.61
PubTator Score 28.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
medulloblastoma, large-cell 1.300 0.000
tuberculosis -1.300 0.005
non-small cell lung cancer -1.107 0.000
lung cancer -1.600 0.001
lung carcinoma -1.500 0.000

Gene RIF (14)

PMID Text
26636523 TM7SF4 plays an essential role in regulating cell cycle progression in breast cancer.
25891874 Our findings also suggest that next generation sequencing may help explore the pathogenesis and aid the diagnosis of Juvenile Paget's disease.
25151085 The EP in TKA differed from EP in aseptically failed THA by lower CCL3 and DC-STAMP mRNA and protein expression. EP of all studied inflammatory and osteoclastogenic molecules were similar in knee and hip OA.
24370779 Rs62620995 in the TM7SF4 gene was found to have a marginal association with Paget's disease of bone in the French-Canadian population.
23525827 DC-STAMP inhibition by RNA interference consequently suppressed fusion and bone resorption of human osteoclasts.
22058328 Results show that T cells played a pivotal role in a new in vitro Langhans giant cells (LGCs) formation system, in which DC-STAMP was involved, and occurred via a molecular mechanism that involved CD40-CD40L interaction and IFN-gamma secretion.
21987375 DC-STAMP is a potential osteoclast precursors biomarker in inflammatory arthritis.
21987375 DC-STAMP is an ITIM-bearing molecule. Based on the 4 distinct patterns of DCSTAMP on human PBMC, it has potential to serve as a susceptible biomarker of psoriasis (Ps) as well as severity marker of Psoriatic Arthritis (PsA).
20839008 genetic risk for Paget's disease of bone is associated with variants close to CSF1, OPTN, TM7SF4, and TNFRSF11A genes
20797317 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MGIWTSGTDIFLSLWEIYVSPRSPGWMDFIQHLGVCCLVALISVGLLSVAACWFLPSIIAAAASWIITCV      1 - 70
LLCCSKHARCFILLVFLSCGLREGRNALIAAGTGIVILGHVENIFHNFKGLLDGMTCNLRAKSFSIHFPL     71 - 140
LKKYIEAIQWIYGLATPLSVFDDLVSWNQTLAVSLFSPSHVLEAQLNDSKGEVLSVLYQMATTTEVLSSL    141 - 210
GQKLLAFAGLSLVLLGTGLFMKRFLGPCGWKYENIYITRQFVQFDERERHQQRPCVLPLNKEERRKYVII    211 - 280
PTFWPTPKERKNLGLFFLPILIHLCIWVLFAAVDYLLYRLIFSVSKQFQSLPGFEVHLKLHGEKQGTQDI    281 - 350
IHDSSFNISVFEPNCIPKPKFLLSETWVPLSVILLILVMLGLLSSILMQLKILVSASFYPSVERKRIQYL    351 - 420
HAKLLKKRSKQPLGEVKRRLSLYLTKIHFWLPVLKMIRKKQMDMASADKS                        421 - 470
//

Text Mined References (23)

PMID Year Title
26636523 2015 Transmembrane 7 superfamily member 4 regulates cell cycle progression in breast cancer cells.
25891874 2015 Polymorphisms of CSF1 and TM7SF4 genes in a case of mild juvenile Paget's disease found using next-generation sequencing.
25151085 2014 Comparison of periprosthetic tissues in knee and hip joints: differential expression of CCL3 and DC-STAMP in total knee and hip arthroplasty and similar cytokine profiles in primary knee and hip osteoarthritis.
24370779 2014 Identification of rare genetic variants in novel loci associated with Paget's disease of bone.
23525827 2013 Lentivirus-mediated RNA interference of DC-STAMP expression inhibits the fusion and resorptive activity of human osteoclasts.
22058328 2012 The CD40-CD40L axis and IFN-? play critical roles in Langhans giant cell formation.
21987375 2012 Regulation of human osteoclast development by dendritic cell-specific transmembrane protein (DC-STAMP).
21623375 2011 Genome-wide association identifies three new susceptibility loci for Paget's disease of bone.
20839008 2010 The majority of the genetic risk for Paget's disease of bone is explained by genetic variants close to the CSF1, OPTN, TM7SF4, and TNFRSF11A genes.
20797317 2010 Analysis of copy number variation in 8,842 Korean individuals reveals 39 genes associated with hepatic biomarkers AST and ALT.
More...