Property Summary

NCBI Gene PubMed Count 23
PubMed Score 97.34
PubTator Score 28.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (5)

Disease log2 FC p
lung cancer -1.600 1.2e-03
lung carcinoma -1.500 6.1e-07
medulloblastoma, large-cell 1.300 2.3e-04
non-small cell lung cancer -1.107 3.4e-09
tuberculosis -1.300 5.4e-03

Gene RIF (15)

AA Sequence

MGIWTSGTDIFLSLWEIYVSPRSPGWMDFIQHLGVCCLVALISVGLLSVAACWFLPSIIAAAASWIITCV      1 - 70
LLCCSKHARCFILLVFLSCGLREGRNALIAAGTGIVILGHVENIFHNFKGLLDGMTCNLRAKSFSIHFPL     71 - 140
LKKYIEAIQWIYGLATPLSVFDDLVSWNQTLAVSLFSPSHVLEAQLNDSKGEVLSVLYQMATTTEVLSSL    141 - 210
GQKLLAFAGLSLVLLGTGLFMKRFLGPCGWKYENIYITRQFVQFDERERHQQRPCVLPLNKEERRKYVII    211 - 280
PTFWPTPKERKNLGLFFLPILIHLCIWVLFAAVDYLLYRLIFSVSKQFQSLPGFEVHLKLHGEKQGTQDI    281 - 350
IHDSSFNISVFEPNCIPKPKFLLSETWVPLSVILLILVMLGLLSSILMQLKILVSASFYPSVERKRIQYL    351 - 420
HAKLLKKRSKQPLGEVKRRLSLYLTKIHFWLPVLKMIRKKQMDMASADKS                        421 - 470
//

Text Mined References (24)

PMID Year Title