Property Summary

NCBI Gene PubMed Count 61
PubMed Score 30.66
PubTator Score 102.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

Gene RIF (53)

AA Sequence

MRERPRLGEDSSLISLFLQVVAFLAMVMGTHTYSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRH      1 - 70
PESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVF     71 - 140
YRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG                                     141 - 177
//

Text Mined References (61)

PMID Year Title