Property Summary

NCBI Gene PubMed Count 52
PubMed Score 75.55
PubTator Score 102.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Expression

Synonym

Accession Q9H293 Q2M3F0 Q8IZV3 Q8WXB0 IL-25
Symbols IL17E

Gene

  Ortholog (8)

Gene RIF (44)

PMID Text
27089063 Findings indicate that the release of interleukin 25 (IL-25) from tumour-associated fibroblasts (TAFs) may serve as a check point for control of mammary tumour metastasis.
27000993 Therefore, IL-17E/IL-17RB signaling represents a potential therapeutic target for treatment of hepatocellular carcinoma
26845056 IL-8 and IL-25 are targets of miR-20b.
26762527 Our findings indicate that the alarmin cytokines IL-33 and IL-25 increase basophil activation and migratory potential, and may pose as a novel therapeutic targets for the treatment of allergic asthma.
26356122 expression of immunoreactivity for IL-17A, IL-17RA, IL-17E, and IL-17F was significantly elevated in prostatic tissue from benign prostatic hyperplasia and prostate cancer compared with that in controls
26347322 The IL17E rs79877597 SNP was a modifier of the risk for psoriasis disease severity and psoriatic arthritis.
26321145 IL-25 upregulated PD-L1 surface expression through the signaling pathways of JNK and STAT3, with STAT3 found to constitutively occupy the proximal region of the PD-L1 promoter.
25975248 IL-25 overexpression was observed in eosinophilic chronic rhinosinusitis and may serve as a mediator of eosinophilic CRS.
25903653 we have demonstrated that the expression of ET-1 and IL-25 was coordinately upregulated in the lesional keratinocytes of patients with AD and a murine AD model.
25705788 This article focuses on evidence for the role of IL-25, IL-33 and TSLP in human allergic disease; although this triad of cytokines is described as epithelial derived, it is clear that their expression within lung tissue is much more widespread.[Review]
More...

AA Sequence

MRERPRLGEDSSLISLFLQVVAFLAMVMGTHTYSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRH      1 - 70
PESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVF     71 - 140
YRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG                                     141 - 177
//

Text Mined References (52)

PMID Year Title
27089063 2016 Induction of IL-25 secretion from tumour-associated fibroblasts suppresses mammary tumour metastasis.
27000993 2016 Non-CSCs nourish CSCs through interleukin-17E-mediated activation of NF-?B and JAK/STAT3 signaling in human hepatocellular carcinoma.
26845056 2015 Disease-specific signature of serum miR-20b and its targets IL-8 and IL-25, in myasthenia gravis patients.
26762527 2016 IL-25 and IL-33 induce Type 2 inflammation in basophils from subjects with allergic asthma.
26356122 2015 Expression of IL-17A, E, and F and their receptors in human prostatic cancer: Comparison with benign prostatic hyperplasia.
26347322 2015 Association between single nucleotide polymorphisms IL17RA rs4819554 and IL17E rs79877597 and Psoriasis in a Spanish cohort.
26321145 2015 Interleukin-25 Mediates Transcriptional Control of PD-L1 via STAT3 in Multipotent Human Mesenchymal Stromal Cells (hMSCs) to Suppress Th17 Responses.
25975248 Interleukin-25 and interleukin-33 as mediators of eosinophilic inflammation in chronic rhinosinusitis.
25903653 2015 Mutual upregulation of endothelin-1 and IL-25 in atopic dermatitis.
25705788 2015 Epithelial cytokines and pulmonary allergic inflammation.
More...