Property Summary

NCBI Gene PubMed Count 52
Grant Count 100
R01 Count 40
Funding $16,026,487.89
PubMed Score 75.55
PubTator Score 102.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

Synonym

Accession Q9H293 Q2M3F0 Q8IZV3 Q8WXB0 IL-25
Symbols IL17E

Gene

Gene RIF (44)

PMID Text
27089063 Findings indicate that the release of interleukin 25 (IL-25) from tumour-associated fibroblasts (TAFs) may serve as a check point for control of mammary tumour metastasis.
27000993 Therefore, IL-17E/IL-17RB signaling represents a potential therapeutic target for treatment of hepatocellular carcinoma
26845056 IL-8 and IL-25 are targets of miR-20b.
26762527 Our findings indicate that the alarmin cytokines IL-33 and IL-25 increase basophil activation and migratory potential, and may pose as a novel therapeutic targets for the treatment of allergic asthma.
26356122 expression of immunoreactivity for IL-17A, IL-17RA, IL-17E, and IL-17F was significantly elevated in prostatic tissue from benign prostatic hyperplasia and prostate cancer compared with that in controls
26347322 The IL17E rs79877597 SNP was a modifier of the risk for psoriasis disease severity and psoriatic arthritis.
26321145 IL-25 upregulated PD-L1 surface expression through the signaling pathways of JNK and STAT3, with STAT3 found to constitutively occupy the proximal region of the PD-L1 promoter.
25975248 IL-25 overexpression was observed in eosinophilic chronic rhinosinusitis and may serve as a mediator of eosinophilic CRS.
25903653 we have demonstrated that the expression of ET-1 and IL-25 was coordinately upregulated in the lesional keratinocytes of patients with AD and a murine AD model.
25705788 This article focuses on evidence for the role of IL-25, IL-33 and TSLP in human allergic disease; although this triad of cytokines is described as epithelial derived, it is clear that their expression within lung tissue is much more widespread.[Review]
More...

AA Sequence

MRERPRLGEDSSLISLFLQVVAFLAMVMGTHTYSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRH      1 - 70
PESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVF     71 - 140
YRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG                                     141 - 177
//

Text Mined References (52)

PMID Year Title
27089063 2016 Induction of IL-25 secretion from tumour-associated fibroblasts suppresses mammary tumour metastasis.
27000993 2016 Non-CSCs nourish CSCs through interleukin-17E-mediated activation of NF-?B and JAK/STAT3 signaling in human hepatocellular carcinoma.
26845056 2015 Disease-specific signature of serum miR-20b and its targets IL-8 and IL-25, in myasthenia gravis patients.
26762527 2016 IL-25 and IL-33 induce Type 2 inflammation in basophils from subjects with allergic asthma.
26356122 2015 Expression of IL-17A, E, and F and their receptors in human prostatic cancer: Comparison with benign prostatic hyperplasia.
26347322 2015 Association between single nucleotide polymorphisms IL17RA rs4819554 and IL17E rs79877597 and Psoriasis in a Spanish cohort.
26321145 2015 Interleukin-25 Mediates Transcriptional Control of PD-L1 via STAT3 in Multipotent Human Mesenchymal Stromal Cells (hMSCs) to Suppress Th17 Responses.
25975248 Interleukin-25 and interleukin-33 as mediators of eosinophilic inflammation in chronic rhinosinusitis.
25903653 2015 Mutual upregulation of endothelin-1 and IL-25 in atopic dermatitis.
25705788 2015 Epithelial cytokines and pulmonary allergic inflammation.
More...