Property Summary

NCBI Gene PubMed Count 16
PubMed Score 14.53
PubTator Score 6.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 6.35036042294211E-6
osteosarcoma 7933 1.36871076617403E-5
Disease Target Count Z-score Confidence
ARC syndrome 14 5.17 2.6

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.488 0.000
ovarian cancer 1.700 0.000

Synonym

Accession Q9H269 Q5JUB1 Q8WU31 Q96EE7 Q96N92 Q9H1Q4 Q9H1Q5 hVPS16
Symbols hVPS16

Gene

PDB

4BX9  

  Ortholog (15)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG
C. elegans OMA Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae EggNOG Inparanoid

 GO Function (1)

Pathway (1)

Gene RIF (1)

PMID Text
23901104 HOPS subunit Vps16 recruits Vps33A to the human HOPS complex; residues 642-736 are necessary and sufficient for this interaction.

AA Sequence

MDCYTANWNPLGDSAFYRKYELYSMDWDLKEELRDCLVAAAPYGGPIALLRNPWRKEKAASVRPVLDIYS      1 - 70
ASGMPLASLLWKSGPVVSLGWSAEEELLCVQEDGAVLVYGLHGDFRRHFSMGNEVLQNRVLDARIFHTEF     71 - 140
GSGVAILTGAHRFTLSANVGDLKLRRMPEVPGLQSAPSCWTVLCQDRVAHILLAVGPDLYLLDHAACSAV    141 - 210
TPPGLAPGVSSFLQMAVSFTYRHLALFTDTGYIWMGTASLKEKLCEFNCNIRAPPKQMVWCSRPRSKERA    211 - 280
VVVAWERRLMVVGDAPESIQFVLDEDSYLVPELDGVRIFSRSTHEFLHEVPAASEEIFKIASMAPGALLL    281 - 350
EAQKEYEKESQKADEYLREIQELGQLTQAVQQCIEAAGHEHQPDMQKSLLRAASFGKCFLDRFPPDSFVH    351 - 420
MCQDLRVLNAVRDYHIGIPLTYSQYKQLTIQVLLDRLVLRRLYPLAIQICEYLRLPEVQGVSRILAHWAC    421 - 490
YKVQQKDVSDEDVARAINQKLGDTPGVSYSDIAARAYGCGRTELAIKLLEYEPRSGEQVPLLLKMKRSKL    491 - 560
ALSKAIESGDTDLVFTVLLHLKNELNRGDFFMTLRNQPMALSLYRQFCKHQELETLKDLYNQDDNHQELG    561 - 630
SFHIRASYAAEERIEGRVAALQTAADAFYKAKNEFAAKATEDQMRLLRLQRRLEDELGGQFLDLSLHDTV    631 - 700
TTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKY    701 - 770
EAKKYASRVGPEQKVKALLLVGDVAQAADVAIEHRNEAELSLVLSHCTGATDGATADKIQRARAQAQKK     771 - 839
//

Text Mined References (23)

PMID Year Title
27174565 2016 Homozygous mutation of VPS16 gene is responsible for an autosomal recessive adolescent-onset primary dystonia.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26463206 2015 Characterization of the Mammalian CORVET and HOPS Complexes and Their Modular Restructuring for Endosome Specificity.
25783203 2015 Recruitment of VPS33A to HOPS by VPS16 Is Required for Lysosome Fusion with Endosomes and Autophagosomes.
25266290 2014 Mammalian CORVET is required for fusion and conversion of distinct early endosome subpopulations.
24554770 2014 The HOPS complex mediates autophagosome-lysosome fusion through interaction with syntaxin 17.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23901104 2013 Structural basis of Vps33A recruitment to the human HOPS complex by Vps16.
23351085 2013 Tethering complexes in the endocytic pathway: CORVET and HOPS.
21269460 2011 Initial characterization of the human central proteome.
More...