Property Summary

NCBI Gene PubMed Count 35
PubMed Score 36.26
PubTator Score 30.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Arthrogryposis renal dysfunction cholestasis syndrome 2 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 8.0e-08
ovarian cancer 8520 1.7e-06
lung cancer 4740 1.2e-02

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 1.100 1.2e-02
osteosarcoma -2.013 8.0e-08
ovarian cancer 1.400 1.7e-06

 GWAS Trait (1)

Gene RIF (17)

AA Sequence

MAFPHRPDAPELPDFSMLKRLARDQLIYLLEQLPGKKDLFIEADLMSPLDRIANVSILKQHEVDKLYKVE      1 - 70
NKPALSSNEQLCFLVRPRIKNMRYIASLVNADKLAGRTRKYKVIFSPQKFYACEMVLEEEGIYGDVSCDE     71 - 140
WAFSLLPLDVDLLSMELPEFFRDYFLEGDQRWINTVAQALHLLSTLYGPFPNCYGIGRCAKMAYELWRNL    141 - 210
EEEEDGETKGRRPEIGHIFLLDRDVDFVTALCSQVVYEGLVDDTFRIKCGSVDFGPEVTSSDKSLKVLLN    211 - 280
AEDKVFNEIRNEHFSNVFGFLSQKARNLQAQYDRRRGMDIKQMKNFVSQELKGLKQEHRLLSLHIGACES    281 - 350
IMKKKTKQDFQELIKTEHALLEGFNIRESTSYIEEHIDRQVSPIESLRLMCLLSITENGLIPKDYRSLKT    351 - 420
QYLQSYGPEHLLTFSNLRRAGLLTEQAPGDTLTAVESKVSKLVTDKAAGKITDAFSSLAKRSNFRAISKK    421 - 490
LNLIPRVDGEYDLKVPRDMAYVFGGAYVPLSCRIIEQVLERRSWQGLDEVVRLLNCSDFAFTDMTKEDKA    491 - 560
SSESLRLILVVFLGGCTFSEISALRFLGREKGYRFIFLTTAVTNSARLMEAMSEVKA                 561 - 617
//

Text Mined References (39)

PMID Year Title