Property Summary

NCBI Gene PubMed Count 59
PubMed Score 104.62
PubTator Score 53.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.600 1.9e-07
osteosarcoma -1.735 1.0e-04
tuberculosis 2.100 3.1e-07

Protein-protein Interaction (4)

Gene RIF (43)

AA Sequence

MSDYENDDECWSVLEGFRVTLTSVIDPSRITPYLRQCKVLNPDDEEQVLSDPNLVIRKRKVGVLLDILQR      1 - 70
TGHKGYVAFLESLELYYPQLYKKVTGKEPARVFSMIIDASGESGLTQLLMTEVMKLQKKVQDLTALLSSK     71 - 140
DDFIKELRVKDSLLRKHQERVQRLKEECEAGSRELKRCKEENYDLAMRLAHQSEEKGAALMRNRDLQLEI    141 - 210
DQLKHSLMKAEDDCKVERKHTLKLRHAMEQRPSQELLWELQQEKALLQARVQELEASVQEGKLDRSSPYI    211 - 280
QVLEEDWRQALRDHQEQANTIFSLRKDLRQGEARRLRCMEEKEMFELQCLALRKDSKMYKDRIEAILLQM    281 - 350
EEVAIERDQAIATREELHAQHARGLQEKDALRKQVRELGEKADELQLQVFQCEAQLLAVEGRLRRQQLET    351 - 420
LVLSSDLEDGSPRRSQELSLPQDLEDTQLSDKGCLAGGGSPKQPFAALHQEQVLRNPHDAGLSSGEPPEK    421 - 490
ERRRLKESFENYRRKRALRKMQKGWRQGEEDRENTTGSDNTDTEGS                            491 - 536
//

Text Mined References (63)

PMID Year Title