Property Summary

NCBI Gene PubMed Count 53
Grant Count 41
R01 Count 31
Funding $4,871,283.2
PubMed Score 89.94
PubTator Score 53.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.600 0.000
osteosarcoma -1.735 0.000
tuberculosis 2.100 0.000

Gene RIF (37)

PMID Text
26722558 We observed no significant association between the investigated CARD9 SNPs and the susceptibility of either Crohn's disease or ulcerative colitis
26679537 our data highlight the critical role of CARD9-dependent neutrophil trafficking into the central nervous system
26521038 Impaired RASGRF1/ERK-mediated GM-CSF response characterizes CARD9 deficiency in French-Canadians.
26498133 This study identified two novel independent loci (MAP3K14 and CARD9) strongly associated with joint damage in Mexican Americans and European Americans and a few shared loci showing suggestive evidence for association.
26488816 A CARD9 variant (protective against inflammatory bowel disease)is C-terminally truncated and acts in a dominant-negative manner for CARD9-mediated cytokine production. K125 is the CARD9 ubiquitinated residue. Ubiquitination is needed for CARD9 activity.
26202982 Data indicate that MINCLE receptor is able to mediate the response to trehalose-6,6-dimycolate (TDM) dependent on SYK kinase and CARD9 protein.
26044242 homozygous mutation results in deep dermatophytosis due to impaired neutrophil fungal killing
25790941 These results indicate that CARD9 is indispensable for Phialophora verrucosa killing by polymorphonuclear neutrophils.
25702837 Invasive infections of the CNS or digestive tract caused by Candida species in previously healthy children and adults might be caused by inherited CARD9 deficiency.
25621893 MyD88 and CARD9 act in two discrete phases and in two cellular compartments to direct chemokine- and neutrophil-dependent host defense.
More...

AA Sequence

MSDYENDDECWSVLEGFRVTLTSVIDPSRITPYLRQCKVLNPDDEEQVLSDPNLVIRKRKVGVLLDILQR      1 - 70
TGHKGYVAFLESLELYYPQLYKKVTGKEPARVFSMIIDASGESGLTQLLMTEVMKLQKKVQDLTALLSSK     71 - 140
DDFIKELRVKDSLLRKHQERVQRLKEECEAGSRELKRCKEENYDLAMRLAHQSEEKGAALMRNRDLQLEI    141 - 210
DQLKHSLMKAEDDCKVERKHTLKLRHAMEQRPSQELLWELQQEKALLQARVQELEASVQEGKLDRSSPYI    211 - 280
QVLEEDWRQALRDHQEQANTIFSLRKDLRQGEARRLRCMEEKEMFELQCLALRKDSKMYKDRIEAILLQM    281 - 350
EEVAIERDQAIATREELHAQHARGLQEKDALRKQVRELGEKADELQLQVFQCEAQLLAVEGRLRRQQLET    351 - 420
LVLSSDLEDGSPRRSQELSLPQDLEDTQLSDKGCLAGGGSPKQPFAALHQEQVLRNPHDAGLSSGEPPEK    421 - 490
ERRRLKESFENYRRKRALRKMQKGWRQGEEDRENTTGSDNTDTEGS                            491 - 536
//

Text Mined References (57)

PMID Year Title
26722558 2015 Genetic association between CARD9 variants and inflammatory bowel disease was not replicated in a Chinese Han population.
26679537 2015 CARD9-Dependent Neutrophil Recruitment Protects against Fungal Invasion of the Central Nervous System.
26521038 2016 Impaired RASGRF1/ERK-mediated GM-CSF response characterizes CARD9 deficiency in French-Canadians.
26498133 2015 Genetic Variants Influencing Joint Damage in Mexican Americans and European Americans With Rheumatoid Arthritis.
26488816 2015 Ubiquitin Ligase TRIM62 Regulates CARD9-Mediated Anti-fungal Immunity and Intestinal Inflammation.
26202982 2015 Contribution of MINCLE-SYK Signaling to Activation of Primary Human APCs by Mycobacterial Cord Factor and the Novel Adjuvant TDB.
26044242 2015 A homozygous CARD9 mutation in a Brazilian patient with deep dermatophytosis.
25790941 2015 CARD9 deficiencies linked to impaired neutrophil functions against Phialophora verrucosa.
25702837 2015 Inherited CARD9 deficiency in otherwise healthy children and adults with Candida species-induced meningoencephalitis, colitis, or both.
25621893 2015 Compartment-specific and sequential role of MyD88 and CARD9 in chemokine induction and innate defense during respiratory fungal infection.
More...